KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2002Help
Entry
c2002             CDS       T00106                                 

Gene name
tus
Definition
(GenBank) DNA replication terminus site-binding protein
  KO
K10748  
DNA replication terminus site-binding protein
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Brite
DNA replication proteins [BR:ecc03032]
 Prokaryotic Type
  DNA Replication Termination Factors
   Terminus site-binding protein
    c2002 (tus)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1844942..1845883
Genome map
AA seq 313 aa AA seqDB search
MVNIMARYDLVDRLNTTFRQMEQELAAFAAELEQHKLLVARVFSLPEVKKEDEHNPLNRI
EVKQHLGNDAQSLALRHFRHLFIQQQSENRSSKAAVRLPGVLCYQVDNFSQAALVSHIQH
INKLKTTFEHIVTVESELPSAARFEWVHRHLPGLITLNAYRTLTVLHDPATLRFGWANKH
IIKNLHRDEVLAQLEKSLKSPRSVAPWTREEWQRKLEREYQDIAALPQNAKLKIKRPVKV
QPIARVWYKGDQKQVQHACPTPLIALINRDNGAGVPDVGELLNYDADNVQHRYKPQAQPL
RLIIPRLHLYVAD
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtggttaatattatggcgcgttacgatctcgtagaccgactcaacactacttttcgccag
atggaacaagagctggctgcatttgccgctgagctagaacagcacaaattgctggttgcc
cgcgtgttctctttgccggaggtaaaaaaagaggatgagcataatccgcttaatcgtatt
gaggtaaaacaacatctcggcaacgacgcgcaatcgctggcgttgcgtcattttcgccat
ttatttattcaacaacagtccgaaaatcgcagcagcaaggccgctgtccgtctgcctggc
gtgttgtgttaccaggtcgataacttttcgcaagcagcgttagtcagtcatattcagcac
atcaataaactcaagaccacgttcgagcatatcgtcacggttgaatcagaactcccctcc
gcggcacgttttgaatgggtgcatcgtcatttgccggggctgattacacttaatgcttac
cgcacgctcaccgttctgcacgaccccgccactttacgttttggctgggctaataaacat
atcattaaaaatttgcatcgtgatgaagtcctggcacagctggaaaaaagcctgaaatca
ccacgcagtgtcgcaccgtggacgcgcgaggagtggcaaagaaaactggagcgagaatat
caggatatcgctgccctgccacagaacgcgaagttaaaaatcaaacgtccggtgaaggtg
cagccgattgcccgcgtctggtacaaaggagatcaaaaacaagtacaacacgcctgccct
acgccgctgattgcactgattaatcgggataatggcgcgggcgtgccagacgttggtgag
ttgttaaattacgatgccgacaatgtgcagcaccgttataaaccacaggcgcagccgctt
cgtttaatcattccacggctgcacctgtatgttgcagattaa

DBGET integrated database retrieval system