KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2004Help
Entry
c2004             CDS       T00106                                 

Gene name
fumA
Definition
(GenBank) Fumarate hydratase class I, aerobic
  KO
K01676  
fumarate hydratase, class I [EC:4.2.1.2]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    c2004 (fumA)
   00620 Pyruvate metabolism
    c2004 (fumA)
Enzymes [BR:ecc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     c2004 (fumA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1847426..1849072)
Genome map
AA seq 548 aa AA seqDB search
MSNKPFHYQAPFPLKKDDTEYYLLTSEHVSVSEFEGQEILKVAPEALTLLARQAFHDASF
MLRPAHQQQVADILRDPEASENDKYVALQFLRNSDIAAKGVLPTCQDTGTAIIVGKKGQR
VWTGGGDEAALARGVYNTYIEDNLRYSQNAPLDMYKEVNTGTNLPAQIDLYAVDGDEYKF
LCIAKGGGSANKTYLYQETKALLTPGKLKNYLVEKMRTLGTAACPPYHIAFVIGGTSAET
NLKTVKLASAKYYDELPTEGNEHGQAFRDVELEKELLIEAQNLGLGAQFGGKYFAHDIRV
IRLPRHGASCPVGMGVSCSADRNIKAKINRQGIWIEKLEHNPGKYIPEELRKAGEGEAVR
VDLNRPMKEILAQLSQYPVSTRLSLNGTIIVGRDIAHAKLKERMDNGEGLPQYIKDHPIY
YAGPAKTPEGYASGSLGPTTAGRMDSYVDQLQAQGGSMIMLAKGNRSQQVTDACKKHGGF
YLGSIGGPAAVLAQGSIKSLECVEYPELGMEAIWKIEVEDFPAFILVDDKGNDFFQQIQL
TQCTRCVK
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacaaaccctttcattatcaggctccttttccactcaaaaaagatgatactgag
tattacctgctaaccagcgaacacgttagcgtatctgaatttgaagggcaggagattttg
aaagtcgcacccgaagcgttaactctgttggcgcgtcaggcgtttcatgatgcgtcattt
atgctgcgtccggctcaccaacaacaggtggccgacattctgcgtgacccggaggccagc
gaaaatgataaatatgtggcgctgcaattcctgcgtaactccgacatcgcggcaaaaggc
gttctgccaacctgtcaggataccggcaccgcgattattgttggtaaaaaagggcagcgt
gtatggaccggtggcggtgatgaagcggcgctggcgcgcggtgtctataacacttatatc
gaggataatctgcgctactcgcaaaacgcgccgctggatatgtataaagaggtgaatacc
ggcaccaacttgccagcgcagatcgatctttatgccgttgatggcgacgagtacaaattc
ctctgtatcgccaaaggtggcggttcggcaaacaagacgtatctctatcaggaaaccaaa
gcgttactgacgccgggaaaactgaaaaattacctggttgagaagatgcgcacgctgggt
acggcggcctgtcctccgtatcatattgcgttcgttattggtggaacttctgcagaaacg
aatcttaaaacggtgaaactcgcttccgctaaatactatgatgaactgccaacggaaggg
aatgagcacggtcaggcgttccgcgatgtggaactggaaaaagaattgctgatcgaagcg
caaaatcttggtctgggtgcgcagtttggtggtaaatacttcgctcatgacatccgcgtg
attcgcctgccacgtcacggcgcatcctgcccggtcggtatgggcgtctcctgttctgct
gaccgtaatatcaaagcgaagatcaaccgtcaggggatctggatcgaaaaactggaacat
aatccaggcaaatatatcccggaagagctgcgcaaagcaggagaaggcgaagcggtgcgc
gttgaccttaaccgtccgatgaaagagatcctcgcacagttgtcgcagtatcccgtttct
acacgcttatcgcttaacggcacgattatcgtcggtcgtgatattgctcacgccaaactg
aaagagcggatggataacggtgaagggctgccgcagtacattaaagatcatccgatttac
tacgcgggtccggccaaaacgccggaaggttatgcctccggttctcttggcccaacgacc
gccggacggatggattcttatgtcgatcaactgcaagcgcagggcggaagtatgatcatg
ctggcgaaaggcaaccgcagccagcaggtgacggatgcctgtaaaaaacacggcggcttc
tacctcggcagtatcggtggtccggcagctgtattggcgcagggaagtattaagagcctg
gaatgtgttgaatatccggaactgggaatggaagccatctggaaaattgaagtggaagat
ttcccggcgtttatccttgtggatgataaaggaaatgacttcttccagcagatacaactc
acacaatgcacccgctgtgtgaaataa

DBGET integrated database retrieval system