KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2006Help
Entry
c2006             CDS       T00106                                 

Gene name
ydgA
Definition
(GenBank) Hypothetical protein ydgA
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1850547..1852055
Genome map
AA seq 502 aa AA seqDB search
MNKSLVAVGVIVALGVVWTGGAWYTGKKIETHLEDMVAQANAQLKLTAPESNLEVSYQNY
HRGVFSSQLQLLVRPIAGKVNPWIKSGQSVIFNESVDHGPFPLAQLKKLNLIPSMASIQT
TLVNNEVSKPLFDMAKGETPFEINSRIGYSGDSSSDISLKPLNYEQKDEKVAFSGGEFQL
NADRDGKAISLSGEAQSGRIDAVNEYNQKVQLTFNNLKTDGSSTLASFGERVGNQKLSLE
KMTISVEGKELALLEGMEISGKSDLVNDGKTVNSQLDYSLNSLKVQNQDLGSGKLTLKVG
QIDGEAWHQFSQQYNAQTQALLAQPEIANNPELYQEKVTEAFFSALPLMLKGDPVITIAP
LSWKNSQGESALNLSLFLKDPATTKEAPQTLAQEVDRSVKSLDAKLTIPVDMATELMTQV
AKLEGYQEDQAKKLAKQQVEGASAMGQMFRLTTLQDNTITTSLQYANGQITLNGQKMPLE
DFVGMFAMPALNVPAVPAIPQQ
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatcgctggtagcggtaggcgtcattgttgcgctaggcgtagtctggacaggc
ggcgcatggtatacaggcaagaagattgaaacccatctcgaagacatggtcgcgcaggcg
aacgcgcaactcaaactgacagctcctgaatccaacctggaagtcagttatcaaaactat
catcgcggcgtattcagcagccagttgcaactgttggtgagacccattgccggaaaagta
aatccgtggattaaaagcggtcagagcgtcatcttcaacgaatcggttgatcatggtccc
ttcccgcttgcccagcttaaaaaactgaacctgatcccgtcgatggcatcaattcaaacc
acgctggttaataacgaagtaagcaaaccactgtttgatatggcaaaaggtgaaacgcct
tttgagattaactcccgcattggttacagcggagattccagttccgacatttcgctcaag
ccactgaattacgagcaaaaggatgaaaaagtcgcatttagcggcggcgagttccagtta
aatgcagacagagacggcaaagctatctccctttccggggaggcgcaaagtggtcggata
gacgcggttaacgaatacaaccagaaagtgcagttaacctttaataatctgaaaaccgac
ggttccagcacgctggcaagttttggtgagcgcgtaggaaaccaaaaactgtcgctggaa
aaaatgaccatttcagtggagggcaaagaactggcactgctggaaggcatggagatcagc
ggtaaatcggatctggtcaatgacggtaaaacggtcaatagccaactggattactcgcta
aacagcctgaaggtacagaatcaggatctgggcagtggcaagctgactttaaaagtcggc
caaattgatggcgaagcctggcatcagtttagccagcaatataacgcgcaaactcaggcg
ctgctggcacagccagaaattgccaacaatcccgaactttatcaggagaaagtgacggaa
gccttctttagcgctctgccgctgatgctgaaaggcgatccggtgattactatcgcgccg
ctaagctggaaaaacagtcagggtgaaagtgcgctgaatctgtcgctgttcctgaaagat
ccggcaacgactaaagaagcgccgcaaacgctggcgcaggaagtggaccggtcggttaaa
tctctggatgcgaaactgaccattccggtggatatggcaactgagttaatgactcaggta
gcgaagctggaaggttatcaggaagatcaagcgaaaaaactggcgaaacagcaagttgaa
ggtgcatcagcaatggggcagatgttccgtctgaccaccttgcaggacaataccatcacc
accagcctgcaatatgctaacggtcagataacgttaaacgggcagaaaatgccactggaa
gatttcgtgggtatgtttgcgatgccggcattaaacgttccggctgtacccgctattccg
cagcagtaa

DBGET integrated database retrieval system