KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2010Help
Entry
c2010             CDS       T00106                                 

Gene name
uidR
Definition
(GenBank) Uid operon repressor
  KO
K16138  
TetR/AcrR family transcriptional regulator, repressor for uid operon
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Brite
Transcription factors [BR:ecc03000]
 Prokaryotic Type
  Helix-turn-helix
   TetR/AcrR family
    c2010 (uidR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1856975..1857565)
Genome map
AA seq 196 aa AA seqDB search
MMDNMQTEAQPTRTRILNAAREIFSENGFHSASMKAICKSCAISPGTLYHHFISKEALIQ
AIILQDQERALARFREPIEGIHFVDYMVESIVSLTHEAFGQRALVVEIMAEGMRNPQVAA
MLKNKHMTITEFVAQRMRDAQQKGEISPDINTAMTSRLLLDLTYGVLADIEAEDLAREAS
FAQGLRAMIGGILTAS
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgatggataacatgcagactgaagcacaaccgacacggacccggatcctcaatgctgcc
agagagattttttcagaaaatggatttcacagtgcctcgatgaaagccatctgtaaatcc
tgcgccattagtcccgggacgctctatcaccatttcatctccaaagaagccttgattcag
gcgattatcttacaggaccaggagagggcgctggcccgtttccgggaaccgattgaaggg
attcatttcgttgactatatggtcgagtctattgtctctctcacccatgaagcctttggg
caacgagcgctggtggtcgaaattatggcggaagggatgcgtaacccacaggtcgccgcc
atgcttaaaaataagcatatgacgatcacggaatttgttgcccagcggatgcgtgatgcc
cagcaaaaaggcgagataagcccagatatcaacacggcaatgacttcacgtttactgctg
gatctgacctacggtgtactggccgatatcgaagcggaagatctggcgcgtgaagcgtcg
tttgctcagggattacgcgcgatgattggcggtatattaaccgcatcctga

DBGET integrated database retrieval system