KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2011Help
Entry
c2011             CDS       T00106                                 

Gene name
hdhA
Definition
(GenBank) 7-alpha-hydroxysteroid dehydrogenase
  KO
K00076  
7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Lipid metabolism
   00121 Secondary bile acid biosynthesis
    c2011 (hdhA)
Enzymes [BR:ecc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     c2011 (hdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1857794..1858561)
Genome map
AA seq 255 aa AA seqDB search
MFNSDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVNEIQQLGG
QAFACRCDITSEQELSALADFAVSKLGKVDILVNNAGGGGPKPFDMPMADFRRAYELNVF
SFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEK
NIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVS
GQILTVSGGGVQELN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgtttaattctgacaacctgagactcgacggaaaatgcgccatcatcacaggtgcgggt
gcaggtattggtaaagaaatcgccattacattcgcgacagctggcgcatctgtggtggtc
agtgatattaacgccgatgcagctaatcatgttgtaaatgaaattcaacaactgggtggt
caggcatttgcctgccgctgcgatattacttccgaacaggaactctctgcactggcagac
tttgccgtcagtaagttgggtaaagttgatatcctggttaacaacgccggtggcggtggg
cctaaaccgtttgatatgccaatggcagattttcgccgcgcttatgaactgaatgtattt
tcttttttccatctgtcacaacttgttgcgccagaaatggaaaaaaatggcggtggcgtt
attctgaccattacttctatggcggcagaaaataaaaatataaacatgacctcctatgca
tcatctaaagctgcggccagtcatctggtcagaaatatggcgtttgacctgggtgaaaaa
aatattcgggtgaatggcattgcaccgggggcaatattaaccgatgccctgaaatccgtt
attacaccagagattgaacagaaaatgttgcaacacacaccaatcagacgtctgggccaa
ccgcaagatattgctaacgcggcgctgttcctttgctcgcctgcagccagctgggtaagc
ggacaaattctcaccgtctccggtggtggggtacaggaactcaattaa

DBGET integrated database retrieval system