KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2012Help
Entry
c2012             CDS       T00106                                 

Gene name
malI
Definition
(GenBank) Maltose regulon Regulatory protein malI
  KO
K16136  
LacI family transcriptional regulator, maltose regulon regulatory protein
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Brite
Transcription factors [BR:ecc03000]
 Prokaryotic Type
  Helix-turn-helix
   LacI family
    c2012 (malI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1858673..1859701)
Genome map
AA seq 342 aa AA seqDB search
MATAKKITIHDVALAAGVSVSTVSLVLSGKGRISTATGERVNAAIEELGFVRNRQASALR
GGQSGVIGLIVRDLSAPFYAELTAGLTEALEAQGRMVFLLHGGKDGEQLAQRFSLLLNQG
VDGVVIAGAAGSSDDLRRIAEEKAIPVIFASRASYLDDVDTVRPDNMQAAQLLTEHLIRN
GHQRIAWLGGQSSSLTLAERVGGYCATLLKFGLPFHSDWVLECTSSQKQAAEAITALLRH
NPTISAVVCYNETIAMGAWFGLLKAGRQSGESGVDRYFEQQVSLAAFTDATPTTLDDIPV
TWASTPARELGTTLADRMMQKITHEETHSRNLIIPARLIAEK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgccaaaaaaataaccattcatgatgttgcgctggctgcgggcgtgtcggta
agtaccgtttcgctggtgcttagtggcaaagggcgaatctctaccgccacaggagaacgc
gttaacgccgccattgaagagctgggatttgtgcgcaatcgccaggcgtcggcgctgcgc
ggcgggcaaagcggcgtcattggtttgatcgtccgtgatttatctgcgccgttttacgcc
gaattgacggccggattgacggaagctctggaagcgcagggacggatggtttttttgctt
cacggcggtaaagacggcgagcagctggcacagcggttttcactattactgaatcagggt
gtcgatggtgtggtcattgccggggctgcaggaagcagcgatgacctgcgacggatagca
gaagaaaaagctatcccggtgattttcgcttcccgtgccagttatcttgatgacgttgat
acggttcgcccggacaacatgcaggctgcacagttgttgacggagcatctcattcgcaat
gggcatcagcgtatcgcctggctgggaggacaaagttcctcattaaccctggcagaacgg
gtggggggctattgtgcgactctactaaaatttggcctgccgtttcacagcgattgggtg
ctggagtgcacttccagccagaagcaagccgcggaagctatcacggcgcttttacgtcat
aacccgaccatcagcgccgtggtttgctataacgaaactattgcgatgggggcatggttt
ggtttgctgaaagcaggaaggcaaagcggggaaagcggagtcgatcgttactttgagcaa
caggtttcgctggcggcatttaccgatgcaacgccaaccacacttgatgatatacccgtt
acctgggccagcacgccagcgcgggaacttggtaccacacttgcggatcgcatgatgcaa
aaaatcacccatgaagagacgcattctcgcaatcttattattcctgcccggctcattgcg
gagaaataa

DBGET integrated database retrieval system