KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2018Help
Entry
c2018             CDS       T00106                                 

Gene name
ydgK
Definition
(GenBank) Hypothetical protein ydgK
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1865749..1866213
Genome map
AA seq 154 aa AA seqDB search
MRRYSGEPMTTTTPQRIGGWLLGPLAWLLVALLSTTLALLLYTAALSSPQTFQTLGGQAL
TTQILWGVSFITAIAMWYYTLWLTIAFFKRRRCVPKHYIIWLLISVLLAVKAFAFSPVED
GIAVRQLLFTLLATALIVPYFKRSSRVKATFVNP
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtcgctattctggagaacctatgaccaccacaacgccacaacgtattggaggctgg
ttgcttggcccgttggcctggcttttagtcgctctgttgagtacgacgctggcgttgttg
ctgtataccgctgcgttatcttctccgcaaacatttcaaacgctcggcggacaagcactg
acgacacaaatcttatggggcgtttcttttattaccgctatcgccatgtggtattacaca
ctgtggttgaccatcgctttctttaaacgtcggcgttgtgttcctaaacactatattatc
tggctgcttatttccgtattgctggcagtaaaagcgttcgctttttcacccgtagaagat
ggcatagccgttcgccagttgctgtttactttgttggcaaccgcattgatcgtcccctat
ttcaaacgctcgtcgcgggtgaaagcgacgtttgtgaatccgtaa

DBGET integrated database retrieval system