KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2022Help
Entry
c2022             CDS       T00106                                 

Gene name
ydgO
Definition
(GenBank) Electron transport complex protein rnfD
  KO
K03614  
electron transport complex protein RnfD
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1869671..1870729
Genome map
AA seq 352 aa AA seqDB search
MVFRIASSPYTHNQRQTSRIMLLVLLAAVPGIAAQLWFFGWGTLVQILLASVSALLAEAL
VLKLRKQSVAATLKDNSALLTGLLLAVSIPPLAPWWMVVLGTVFAVIIAKQLYGGLGQNP
FNPAMIGYVVLLISFPVQMTSWLPPHEIAVNIPGFIDAIQVIFSGHTASGGDMNTLRLGI
DGISQATPLDTFKTSVRAGHSVEQIMQYPIYSGILAGVGWQWVNLAWLAGGVWLLWQKAI
RWHIPLSFLVTLALCATLGWLFSPETLAAPQIHLLSGATMLGAFFILTDPVTASTTNRGR
LIFGALAGLLVWMIRSFGGYPDGVAFAVLLANITVPLIDYYTRPRVYGHRKG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggtattcagaatagctagctccccttatacccataaccagcgccagacatcgcgcatt
atgctgttggtattgctcgcagccgtgccaggaatcgcagcgcaactgtggttttttggt
tggggtactctcgttcagatcctgttggcgtcggtcagtgctcttctggccgaagctctc
gtcctcaaactacgcaagcagtcggtagctgcaacgttgaaagataactcagcattgctg
acaggcttattgctggcggtaagtattccccccctcgcgccatggtggatggtcgtgctg
ggtacggtgtttgcggtgatcatcgctaaacagttgtatggcggtctggggcaaaacccg
tttaatccggcaatgattggttatgtggtcttactgatctccttcccggtgcagatgacc
agttggttaccgccacatgaaattgcggtcaacatccctggttttatcgacgccatacag
gttattttcagcggtcataccgccagtggtggtgatatgaacacgctacgcttaggtatt
gatggcattagtcaggcgacaccgctggatacattcaaaacctctgtccgcgcaggtcat
tcggttgaacagattatgcaatatccgatctacagcggtattctggcgggcgttggttgg
caatgggtaaatctcgcctggctggctggcggcgtatggttgctgtggcagaaagcgatt
cgctggcatattcccctcagcttcttagtaacgctggcgttatgcgcaacgttgggctgg
ttgttctcaccagaaacactggcagcaccgcaaattcatctgctgtctggagcgaccatg
ctcggcgcattctttattttgactgacccggttaccgcttctacgaccaatcgtggtcgt
cttattttcggcgcgctggcgggcttattagtctggatgatccgcagtttcggcggctat
cctgacggcgttgcttttgccgtcctgctggcgaacatcacggttcctctgatcgattac
tacacgcgtccgcgcgtctacggccatcgcaaagggtaa

DBGET integrated database retrieval system