KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2025Help
Entry
c2025             CDS       T00106                                 

Gene name
nth
Definition
(GenBank) Endonuclease III
  KO
K10773  
endonuclease III [EC:4.2.99.18]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    c2025 (nth)
Enzymes [BR:ecc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     c2025 (nth)
DNA repair and recombination proteins [BR:ecc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     c2025 (nth)
 Prokaryotic Type
     c2025 (nth)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1872052..1872687
Genome map
AA seq 211 aa AA seqDB search
MNKAKRLEILTRLRENNPHPTTELNFSSPFELLIAVLLSAQATDVSVNKATAKLYPVANT
PAAMLELGVEGVKTYIKTIGLYNSKAENIIKTCRILLEQHNGEVPEDRAALEALPGVGRK
TANVVLNTAFGWPTIAVDTHIFRVCNRTQFAPGKNVEQVEEKLLKVVPAEFKVDCHHWLI
LHGRYTCIARKPRCGSCIIEDLCEYKEKVDI
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagcaaaacgcctggagatcctcactcgcctgcgtgagaacaatcctcatccc
accaccgagcttaatttcagttcgccttttgaattgctgattgccgtactgctttccgct
caggcgaccgatgtcagtgttaataaggcgacggcgaaactctacccggtggctaatacg
cctgcagcgatgcttgaactgggcgttgaaggggtgaaaacctatatcaaaacgattggc
ctttataacagcaaagcagaaaatatcatcaaaacctgccgtatattactggaacaacat
aatggcgaggttccggaagatcgtgctgcgcttgaagccctgcctggtgtaggtcgtaaa
acagccaacgtcgtattaaacactgcattcggctggccgactattgctgtcgacacgcac
attttccgcgtttgtaatcgtacacaatttgcgccggggaaaaacgtcgaacaggtagaa
gaaaagctactgaaagtggttccggcagagtttaaagtcgactgccaccattggttgatc
ctgcacgggcgttatacctgcattgcccgcaagcctcgctgtggctcttgtattattgaa
gatctttgtgaatacaaagagaaagttgacatctaa

DBGET integrated database retrieval system