KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2029Help
Entry
c2029             CDS       T00106                                 

Gene name
tyrS
Definition
(GenBank) Tyrosyl-tRNA synthetase
  KO
K01866  
tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    c2029 (tyrS)
Enzymes [BR:ecc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     c2029 (tyrS)
Amino acid related enzymes [BR:ecc01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   c2029 (tyrS)
Transfer RNA biogenesis [BR:ecc03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    c2029 (tyrS)
 Prokaryotic Type
    c2029 (tyrS)
Mitochondrial biogenesis [BR:ecc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    c2029 (tyrS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1876477..1877763)
Genome map
AA seq 428 aa AA seqDB search
MEILMASSNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSLHLGHLVPLL
CLKRFQQAGHKPVALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDC
GENSAIAANNYDWFGNMNVLTFLRDIGKHFSVNQMINKEAVKQRLNREDQGISFTEFSYN
LLQGYDFACLNKQYGVVLQIGGSDQWGNITSGIDLTRRLHQNQVFGLTVPLITKADGTKF
GKTEGGAVWLDPKKTSPYKFYQFWINTADADVYRFLKFFTFMSIEEINALEEEDKNSGKA
PRAQYVLAEQVTRLVHGEDGLQAAKRITECLFSGSLSALSEADFEQLAQDGVPMVEMEKG
ADLMQALVDSELQPSRGQARKTIASNAITINGEKQSDPEYFFKEEDRLFGRFTLLRRGKK
NYCLICWK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggagattttgatggcaagcagtaacttgattaaacaattgcaagagcgggggctggta
gcccaggtgacggacgaggaagcgttagcagagcgactggcgcaaggcccgatcgcgctc
tattgcggcttcgatcctaccgctgacagcttgcatttggggcatcttgttccattgtta
tgcctgaaacgcttccagcaggcgggccacaagccggttgcgctggtaggcggcgcgacg
ggtctgattggcgacccgagcttcaaagctgccgagcgtaagctgaacactgaagaaact
gttcaggagtgggtggacaaaatccgcaagcaggttgccccgttcctcgatttcgactgt
ggagaaaactctgctatcgcggcgaacaactatgactggttcggcaatatgaatgtgctg
accttcctgcgcgatattggcaaacacttctccgttaaccagatgatcaacaaagaagcg
gttaagcagcgtctcaaccgtgaagatcaggggatttcgttcactgagttttcctacaac
ctgttgcagggttatgacttcgcctgtctgaacaaacagtacggtgtggtgctgcaaatc
ggtggttctgaccagtggggtaacatcacttctggtatcgacctgacccgtcgtctgcat
cagaatcaggtgtttggcttgaccgttccgctgatcaccaaagcagacggcaccaaattt
ggtaaaactgaaggcggcgcagtctggttggatccgaagaaaaccagcccgtacaaattc
taccagttctggatcaacactgcggatgccgacgtttaccgcttcctgaagttcttcacc
ttcatgagcattgaagagatcaacgccctggaagaagaagataaaaacagcggtaaagca
ccgcgcgcccagtatgtgcttgcagaacaggtgacacgtctggtgcatggtgaagacggt
ttgcaggcggcaaaacgtattaccgaatgcctgttcagcggttccttgagtgcgctgagt
gaagcggacttcgaacagctggcgcaggacggcgtaccgatggttgagatggaaaagggc
gcagacctgatgcaggcgctggtcgattctgaactgcaaccttcccgtggtcaggcgcgt
aaaactatcgcctccaatgccatcaccattaacggtgaaaaacagtccgatcctgaatac
ttctttaaagaagaagatcgtctgtttggtcgttttaccttactgcgtcgtggcaaaaag
aattactgtctgatttgctggaaataa

DBGET integrated database retrieval system