KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2030Help
Entry
c2030             CDS       T00106                                 

Gene name
pdxH
Definition
(GenBank) Pyridoxamine 5'-phosphate oxidase
  KO
K00275  
pyridoxamine 5'-phosphate oxidase [EC:1.4.3.5]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Pyridoxal biosynthesis, erythrose-4P => pyridoxal-5P
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    c2030 (pdxH)
Enzymes [BR:ecc01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.5  pyridoxal 5'-phosphate synthase
     c2030 (pdxH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1877880..1878536)
Genome map
AA seq 218 aa AA seqDB search
MSDNDELQQIAHLRREYTKGGLRRRDLPADPLTLFERWLSQACEAKLADPTAMVVATVDE
HDQPYQRIVLLKHYDEKGMVFYTNLGSRKAHQIENNPRVSLLFPWHTLERQVMVIGKAER
LSTLEVMKYFHSRPRDSQIGAWVSKQSSRISARGILESKFLELKQKFQQGEVPLPSFWGG
FRVSLEQIEFWQGGEHRLHDRFLYQRENDAWKIDRLAP
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataacgacgaattgcagcaaatcgcgcatctgcgccgtgaatacaccaaaggc
gggttacgccgccgcgatctacccgccgatccattaaccctttttgaacgttggctctct
caggcttgtgaagccaaactggctgaccctaccgcgatggtggtcgctaccgtggatgaa
catgatcagccttatcagcgcattgttttactcaaacattacgacgaaaaaggcatggtg
ttttacaccaacctcggcagccgtaaagcacatcaaatcgaaaataatccgcgcgttagc
ctgctgttcccgtggcatacccttgaacgccaggtgatggtgatcggtaaagcggaacga
ctttcgactctcgaagtgatgaaatattttcatagccgcccgcgtgatagccagattggg
gcatgggtttcgaagcagtccagtcgcatttctgcccgcggtatccttgaaagtaaattc
ctggagctgaagcagaagtttcaacagggcgaagtgccattgccaagtttttggggcggt
tttcgcgtcagccttgaacagattgagttctggcagggcggtgagcatcgcctgcatgac
cgctttttgtaccagcgtgaaaatgatgcgtggaagattgatcgtcttgcaccctga

DBGET integrated database retrieval system