KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2034Help
Entry
c2034             CDS       T00106                                 

Gene name
slyA
Definition
(GenBank) Transcriptional regulator slyA
  KO
K06075  
MarR family transcriptional regulator, transcriptional regulator for hemolysin
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Brite
Transcription factors [BR:ecc03000]
 Prokaryotic Type
  Helix-turn-helix
   MarR family
    c2034 (slyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1880919..1881359)
Genome map
AA seq 146 aa AA seqDB search
MKLESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGI
EQPSLVRTLDQLEEKGLISRQTCASDRRAKRIKLTEKAEPLISEMEAVINKTRAEILHGI
SAEELEQLIKLIAKLEHNIIELQAKG
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgaaattggaatcgccactaggttctgatctggcacggttggtgcgcatatggcgtgct
ctgatagaccatcgcctgaaaccgctggagttaacacaaacccattgggttacgttacac
aatatccatcagttacctccagaccagtcgcaaattcaactggcaaaagcgattggcatc
gagcagccatcactggtccgtacgctggaccaactggaagaaaaagggttaatttcgcgt
caaacttgtgccagcgatcgtcgggctaaacgtattaaactgacggaaaaggcagagcca
ttgatcagcgaaatggaagccgttattaacaaaacccgcgcggaaattttacatggcatc
tccgcagaggaactggaacaactgattaagctcatcgcaaaacttgagcataatatcatt
gagttacaggccaaagggtga

DBGET integrated database retrieval system