KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2037Help
Entry
c2037             CDS       T00106                                 

Gene name
ydhK
Definition
(GenBank) Hypothetical protein ydhK
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FUSC FUSC_2 ArAE_1
Motif
Other DBs
NCBI-ProteinID: AAN80497
UniProt: A0A0H2V7L5
Position
1882650..1884662
Genome map
AA seq 670 aa AA seqDB search
MNASSWSLRNLPWFRATLAQWRYALRNTIAMCLALTVAYYLNLDEPYWAMTSAAVVSFPT
VGGVISKSLGRIAGSLLGAIAALLLAGHTLNEPWFFLLSMSAWLGFCTWACAHFTNNVAY
AFQLAGYTAAIIAFPMVNITEASQLWDIAQARVCEVIVGILCGGMMMMILPSSSDATALL
TALKNMHARLLEHASLLWRPETTDAIRAAHEGVIGQILTMNLLRIQAFWSHYRFRQQNAR
LNALLHQQLRMTSVISSLRRMLLNWPSPPDATREILEQLLTALASSQTDVYTVTRIISPL
RPTNVADYRHIAFWQRLRYFCRLYLQSSQELHRLQSGVDDRARLPRTSGLARHTDNAEAM
WSGLRTFCTLMMIGAWSIASQWDAGANALTLAAISCVLYSAVAAPFKSLSLLMRTLVLLS
LFSFVVKFGLMVQISDLWQFLLFLFPLLATMQLLKLQMSKFAALWGQLIVFMGSFIAVTN
PPVYDFADFLNDNLAKIVGVALAWLAFAILRPGSDARKSRRHIRALRRDFVDQLSRHPTL
SESEFESLTYHHVSQLSNSQDALARRWLLRWGVVLLNCSHVVWQLRDWESRSDPLSRVRD
NCISLLRGVMSERGVQQKSLAATLEELQRICDSLARHHQPAARELAAIVWRLYCSLSQLE
QAPPQGTLAS
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcatcgtcatggtccttgcgcaatttgccctggttcagggccacgctggcgcaa
tggcgttatgcgttacgcaataccattgccatgtgtctggcgctgacggttgcctattat
ttgaatcttgatgagccctattgggcgatgacctcggctgcggtggttagctttcccacc
gttggcggtgtcatcagcaaaagcctcggacgcatcgctggcagtttgctcggagccatt
gcggcactgcttcttgccggacatacgctcaatgagccgtggttttttctattgagcatg
tcggcgtggcttggcttttgtacctgggcctgtgcgcacttcacgaataacgtcgcgtat
gcatttcaactggcgggctacacggctgccatcatcgcctttccgatggttaatattact
gaggccagccagctgtgggatatcgctcaggcgcgtgtttgcgaggtgatagtcggtatt
ttgtgcggcggcatgatgatgatgatcctgccgagcagttccgatgctacagccctttta
accgcattgaaaaacatgcacgcccgattactggaacatgccagtttactctggcggcct
gaaacaaccgatgccattcgtgctgcacatgaaggggtgattgggcagatactgaccatg
aatttgctgcgtatccaggctttctggagccactatcgttttcgccagcaaaacgcacgc
cttaatgcgctactccaccagcaattacgtatgaccagtgtcatctccagcctgcgacgt
atgttgctcaactggccctcaccgccagatgccacgcgagaaattctcgaacagctgctg
acggcgctcgccagttcgcaaacagatgtttacaccgtcacacgtattatctccccacta
cgcccgaccaacgtcgccgactaccggcacatcgccttctggcagcgactacgttatttt
tgccgcctttatctgcaaagtagtcaggaattacatcgtctgcaaagcggtgtagatgat
cgtgccagactcccacggacatccggcctggctcgtcataccgataacgccgaagctatg
tggagcgggctgcgtacattttgtacgttgatgatgattggcgcatggagtattgcttcg
caatgggatgcaggtgccaatgcattaacgctggcagcgattagctgcgtactctactcc
gccgtcgcggcaccgtttaagtcgttgtcactgctgatgcgcacgctggtgttactttcg
ctattcagctttgtggtcaaatttggcctgatggtgcagattagcgatctgtggcaattt
ttactgtttctctttccactgctggcgacgatgcagcttcttaaattgcagatgtccaaa
tttgccgcactgtgggggcaactgattgtttttatgggttcgtttatcgctgtcactaat
ccccccgtgtatgattttgctgattttcttaacgataatctggcaaaaattgttggcgtc
gcgttggcgtggttagcgttcgccattctgcgtccaggatcggatgctcgtaaaagccgc
cgccatattcgcgcgctgcgccgggattttgtcgatcaactaagccgccatccaacactg
agtgaaagcgaatttgaatcgctcacttatcatcacgtcagtcagttgagtaacagccag
gatgcgctggctcgccgttggttattacgctggggtgtagtgttgctgaactgttctcat
gttgtctggcaattgcgcgactgggaatcgcgttccgatccgttatcgcgagtacgggat
aactgtatttcactgttgcggggagtgatgagtgagcgtggcgttcagcaaaaatcactg
gcggccacacttgaagaattacagcgaatttgcgacagccttgcccgtcatcatcaacct
gccgcccgagaactagcggcaattgtctggcggctgtactgctcgctttcgcaacttgag
caagcaccgccgcaaggtacgctggcttcttaa

DBGET integrated database retrieval system