KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2038Help
Entry
c2038             CDS       T00106                                 

Gene name
sodC
Definition
(GenBank) Superoxide dismutase [Cu-Zn] precursor
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Brite
Enzymes [BR:ecc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     c2038 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1884663..1885235)
Genome map
AA seq 190 aa AA seqDB search
MCHWFTLIQECTMNGGPMKRFSLAILALVVATGAQAASEKVEMNLVTSQGVGQSIGSVTI
TETDKGLEFSPDLKALPPGEHGFHIHAKGSCQPATKDGKASAAESAGGHLDPQNTGKHEG
PEGAGHLGDLPALVVNNDGKATDAVIAPRLKSLDEVKDKALMVHVGGDNMSDQPKPLGGG
GERYACGVIK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcactggtttacacttattcaggaatgcacaatgaacggaggtcctatgaaacgt
tttagtctggccattctggcgctggttgttgcgaccggcgcacaagctgccagtgaaaaa
gtcgagatgaacctcgtcacgtcgcaaggggttgggcagtcaattggtagcgtcaccatt
actgaaaccgataaaggtctggagttttcgcccgatctgaaagcattacctcccggtgaa
catggcttccatattcatgccaaaggaagctgccagccagccaccaaagatggcaaagcc
agcgccgcagaatccgcaggcgggcatcttgatccacaaaataccggtaaacatgaaggg
ccagaaggtgccgggcatttaggcgatctgcctgcactggtagtcaataatgacggcaag
gcgaccgatgccgtcatcgcgcctcgtctgaaatcactggatgaagtcaaagacaaagcg
ctgatggtccacgttggcggcgataatatgtccgatcaacccaaaccgctgggcggtggc
ggtgaacgctatgcctgtggtgtaattaagtaa

DBGET integrated database retrieval system