KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2040Help
Entry
c2040             CDS       T00106                                 

Gene name
ydhL
Definition
(GenBank) Hypothetical protein ydhL precursor
  KO
K06938  
uncharacterized protein
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1886210..1886587)
Genome map
AA seq 125 aa AA seqDB search
MFASIMFGVFVHALECSRPVGLVQAKLLLWTLTASIMVIILSEEGEVTEQLEFFPVQSPC
RGICQSDERGFCRGCFRSRDERFNWNKMSDGEKQEVLRLCRQRLMRKLRVNKPAPSDEPE
QPSLF
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcgagtatcatgttcggtgtgtttgttcatgcgttggagtgtagtagaccagtc
ggtctagtgcaagcaaagttgctactttggacattaacagcttcaataatggtaataatc
ttatctgaggagggcgaggtgacggagcaattagagttctttcccgtccagagcccgtgc
cggggaatttgccagtctgacgaacggggattttgtcgcggctgttttcgtagccgggat
gagcgttttaactggaataagatgagcgatggcgaaaaacaagaagtgttgcgcctttgt
cggcagcgattaatgcgcaaattacgtgtaaataagccagcgccatcagacgaaccggag
caaccatcactcttttga

DBGET integrated database retrieval system