KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2044Help
Entry
c2044             CDS       T00106                                 

Gene name
gloA
Definition
(GenBank) Lactoylglutathione lyase
  KO
K01759  
lactoylglutathione lyase [EC:4.4.1.5]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
Pyruvate metabolism
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    c2044 (gloA)
Enzymes [BR:ecc01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.5  lactoylglutathione lyase
     c2044 (gloA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1888366..1888773
Genome map
AA seq 135 aa AA seqDB search
MRLLHTMLRVGDLQRSIDFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYN
WGVDKYELGTAYGHIALSVDNAAEACEKIRQNGGNVTREAGPVKGGTTVIAFVEDPDGYK
IELIEEKDAGRGLGN
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcttcttcataccatgctgcgcgttggcgatctgcaacgctccatcgatttttat
accaacgtgctgggcatgaaactgctgcgtaccagcgaaaacccggaatacaaatactca
ctggcgtttgttggttacggcccggaaaccgaagaagcagtgattgaactgacctacaac
tggggcgtggataaatacgaactcggcactgcttatggtcacatcgcgcttagcgtagat
aacgccgctgaagcgtgcgaaaaaatccgtcaaaacgggggtaacgtaacccgtgaagcg
ggtccggtaaaaggcggtactacggttatcgcatttgtggaagatccggacggttacaaa
attgaattaatcgaagagaaagacgccggtcgcggtctgggcaactaa

DBGET integrated database retrieval system