KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2045Help
Entry
c2045             CDS       T00106                                 

Gene name
rnt
Definition
(GenBank) Ribonuclease T
  KO
K03683  
ribonuclease T [EC:3.1.13.-]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Brite
Enzymes [BR:ecc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.-  
     c2045 (rnt)
Transfer RNA biogenesis [BR:ecc03016]
 Prokaryotic Type
  3'processing and CCA adding factors
   3'processing factors
    c2045 (rnt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1888876..1889523
Genome map
AA seq 215 aa AA seqDB search
MSDNAQLTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHF
HVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAH
NANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQA
HSALYDTERTAVLFCEIVNRWKRLGGWPLPAAEEV
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtccgataacgctcaacttaccggtctgtgcgaccgttttcgtggtttttatcctgtt
gtgatcgatgttgaaacagccggatttaacgccaaaaccgatgcgctgcttgagattgcc
gccatcaccctgaaaatggatgaacaaggctggctgatgccggacaccacattacatttc
cacgtcgaaccatttgtcggcgcaaatttgcaaccagaggcccttgccttcaatggcatt
gatccgaacgatcccgatcgcggcgcggtcagcgagtacgaggcgctgcacgaaattttt
aaagttgtacgtaaaggtattaaagcgagcggctgtaaccgcgccattatggtggcgcac
aacgccaatttcgatcacagctttatgatggccgccgcagaacgcgcctcactgaaacgt
aacccgttccaccctttcgccacttttgacactgctgcactggccgggctggcactcgga
caaaccgtattgtcaaaggcttgccagaccgctggcatggacttcgacagcacccaggcg
cactccgcgttgtacgacaccgaacgcactgctgtgctgttttgtgaaatcgtcaaccgc
tggaaacgtctgggaggctggccgctacctgccgccgaagaggtgtaa

DBGET integrated database retrieval system