KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2048Help
Entry
c2048             CDS       T00106                                 

Gene name
ydhD
Definition
(GenBank) Protein ydhD
  KO
K07390  
monothiol glutaredoxin
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Brite
Chaperones and folding catalysts [BR:ecc03110]
 Protein folding catalysts
  Protein disulfide isomerase
   c2048 (ydhD)
Mitochondrial biogenesis [BR:ecc03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    c2048 (ydhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1889895..1890242)
Genome map
AA seq 115 aa AA seqDB search
MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRA
ELPKYANWPTFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKYKSEEPDAE
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccactatcgaaaaaatccaacgccagattgctgaaaacccgatcctgctgtac
atgaaaggttcaccgaaactgccgagctgcggtttctctgcccaggcagtccaggcgctt
gccgcatgtggcgaacgttttgcctatgttgatattctgcagaatccggacattcgtgcg
gaactgccgaaatatgcgaactggccgaccttcccgcaactgtgggttgacggcgagctg
gtgggcggttgtgatatcgtgatcgaaatgtatcagcgtggtgaactgcagcagctgatc
aaagaaactgccgctaaatacaagtctgaagagccggacgcggaataa

DBGET integrated database retrieval system