KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2106Help
Entry
c2106             CDS       T00106                                 

Gene name
btuE
Definition
(GenBank) Vitamin B12 transport periplasmic protein btuE
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00480  Glutathione metabolism
ecc00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    c2106 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    c2106 (btuE)
Enzymes [BR:ecc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     c2106 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin
Motif
Other DBs
NCBI-ProteinID: AAN80566
UniProt: A0A0H2V7R3
Position
complement(1949526..1950077)
Genome map
AA seq 183 aa AA seqDB search
MQDSILTTVVKDIDGEVTTLEKYAGNVLLIVNVASKCGLTPQYEQLENIQKAWADRGFVV
LGFPCNQFLEQEPGSDEEIKTYCTTTWGVTFPMFSKIEVNGEGRHPLYQKLIAAAPTAVA
PEESGFYARMVSKGRAPLYPDDILWNFEKFLVGRDGKVIQRFSPDMTPEDPIVMESIKLA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaagattccattctgacgaccgtagtgaaagatatcgacggtgaagtgaccacgctg
gagaagtacgccggtaatgtgctgttgattgtcaatgtcgcctcaaagtgtggcttaacg
ccgcaatatgagcagttggagaatattcagaaagcctgggctgatcgtggttttgtggtg
ctgggattcccgtgtaaccagtttctggagcaagaaccgggtagcgatgaagagattaaa
acttactgcaccaccacatggggggtgacgttcccgatgttcagtaagattgaagttaat
ggcgaaggacgccatccgctgtatcaaaaattgattgccgcagcgccgactgcagtcgcg
ccggaagagagcggattctatgcccgtatggtcagcaaaggtcgtgcaccgctgtaccct
gatgatattttatggaattttgagaaatttttagttggcagggacggaaaggtcatccag
cgtttttccccggatatgacgccggaagatcccattgtgatggaaagcattaaactggcg
ttggcaaaataa

DBGET integrated database retrieval system