KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2121Help
Entry
c2121             CDS       T00106                                 

Gene name
pfkB
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    c2121 (pfkB)
   01230 Biosynthesis of amino acids
    c2121 (pfkB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    c2121 (pfkB)
   00030 Pentose phosphate pathway
    c2121 (pfkB)
   00051 Fructose and mannose metabolism
    c2121 (pfkB)
   00052 Galactose metabolism
    c2121 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    c2121 (pfkB)
Enzymes [BR:ecc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     c2121 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1961463..1962395
Genome map
AA seq 310 aa AA seqDB search
MMVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGTATAIF
PAGGATGEHLVSLLAHENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFR
QLEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQGIRCIVDSSGEALSAALAIG
NIELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCI
QVVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSHDD
TQKIYAYLSR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgatggtacgtatctatacgttgacacttgcgccctctcttgatagcgcaacaattacc
ccgcaaatttatcccgaaggaaaactgcgctgtaccgcaccggtgttcgaacccggtggc
ggcggcatcaacgtcgcccgcgccattgcccatcttggaggcactgccacagcgatcttc
ccggcgggtggcgcgaccggcgaacatctggtttcactgttggcgcatgaaaatgtcccc
gtcgctactgtagaagccaaagactggacccggcagaatttacacgtacatgtggaagca
agcggtgagcagtatcgttttgttatgccaggcgcggcattaaatgaagatgagtttcgc
cagctcgaagagcaagttctggaaattgaatccggggccatcctggtcataagcggaagc
ctgccgccaggtgtgaagctggaaaaattaacccaactgatttccgctgcgcaaaaacaa
gggatccgctgcatcgtcgacagttctggcgaagcgttaagtgcagcactggcgattggt
aacatcgagttggttaagcctaaccaaaaagaactcagtgcgctggtaaatcgcgaactc
acccagccagacgatgtccgcaaagccgcgcaggaaatcgttaatagcggcaaggccaaa
cgggttgtcgtttccctgggtccacaaggggcgctgggcgttgatagtgaaaactgcatt
caggtggtgccaccaccggtgaaaagccagagtaccgttggcgctggtgacagcatggtc
ggcgcgatgacacttaaactggcagaaaatgcctctcttgaagagatggtccgttttggc
gtagctgcggggagtgcagccacactcaaccagggaacacgcctgtgctcccatgacgat
acgcaaaaaatttacgcgtacctttcccgctaa

DBGET integrated database retrieval system