KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2121Help
Entry
c2121             CDS       T00106                                 

Gene name
pfkB
Definition
(GenBank) 6-phosphofructokinase isozyme 2
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00010  Glycolysis / Gluconeogenesis
ecc00030  Pentose phosphate pathway
ecc00051  Fructose and mannose metabolism
ecc00052  Galactose metabolism
ecc00680  Methane metabolism
ecc01100  Metabolic pathways
ecc01110  Biosynthesis of secondary metabolites
ecc01120  Microbial metabolism in diverse environments
ecc01130  Biosynthesis of antibiotics
ecc01200  Carbon metabolism
ecc01230  Biosynthesis of amino acids
Module
ecc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    c2121 (pfkB)
   00030 Pentose phosphate pathway
    c2121 (pfkB)
   00051 Fructose and mannose metabolism
    c2121 (pfkB)
   00052 Galactose metabolism
    c2121 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    c2121 (pfkB)
Enzymes [BR:ecc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     c2121 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin DUF2617
Motif
Other DBs
NCBI-ProteinID: AAN80580
UniProt: A0A0H2V7Q1
Structure
PDB: 

Jmol
Position
1961463..1962395
Genome map
AA seq 310 aa AA seqDB search
MMVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGTATAIF
PAGGATGEHLVSLLAHENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFR
QLEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQGIRCIVDSSGEALSAALAIG
NIELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCI
QVVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSHDD
TQKIYAYLSR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgatggtacgtatctatacgttgacacttgcgccctctcttgatagcgcaacaattacc
ccgcaaatttatcccgaaggaaaactgcgctgtaccgcaccggtgttcgaacccggtggc
ggcggcatcaacgtcgcccgcgccattgcccatcttggaggcactgccacagcgatcttc
ccggcgggtggcgcgaccggcgaacatctggtttcactgttggcgcatgaaaatgtcccc
gtcgctactgtagaagccaaagactggacccggcagaatttacacgtacatgtggaagca
agcggtgagcagtatcgttttgttatgccaggcgcggcattaaatgaagatgagtttcgc
cagctcgaagagcaagttctggaaattgaatccggggccatcctggtcataagcggaagc
ctgccgccaggtgtgaagctggaaaaattaacccaactgatttccgctgcgcaaaaacaa
gggatccgctgcatcgtcgacagttctggcgaagcgttaagtgcagcactggcgattggt
aacatcgagttggttaagcctaaccaaaaagaactcagtgcgctggtaaatcgcgaactc
acccagccagacgatgtccgcaaagccgcgcaggaaatcgttaatagcggcaaggccaaa
cgggttgtcgtttccctgggtccacaaggggcgctgggcgttgatagtgaaaactgcatt
caggtggtgccaccaccggtgaaaagccagagtaccgttggcgctggtgacagcatggtc
ggcgcgatgacacttaaactggcagaaaatgcctctcttgaagagatggtccgttttggc
gtagctgcggggagtgcagccacactcaaccagggaacacgcctgtgctcccatgacgat
acgcaaaaaatttacgcgtacctttcccgctaa

DBGET integrated database retrieval system