KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2172Help
Entry
c2172             CDS       T00106                                 

Gene name
ydjB
Definition
(GenBank) Pyrazinamidase/nicotinamidase
  KO
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    c2172 (ydjB)
Enzymes [BR:ecc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     c2172 (ydjB)
    3.5.1.-  
     c2172 (ydjB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2009098..2009757
Genome map
AA seq 219 aa AA seqDB search
MIKETAMPPRALLLVDLQNDFCAGGALAVPEGDSTVDVANRLIDWCQSRGEAVIASQDWH
PANHGSFASQHGVEPYTPGQLDGLPQTFWPDHCVQNSEGAQLHPLLKQKAIAAVFHKGEN
PLVDSYSAFFDNGRRQKTALDDWLRAHVINELIVMGLATDYCVKFTVLDALQLGYKVNVI
TDGCRGVNIQPQDSAHAFMEMSAAGATLYTLADWEETQE
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgattaaggagactgcaatgccccctcgcgccctgttactggtcgatttacaaaatgat
ttctgtgctggtggcgcgctcgccgtgccggaaggtgacagtacggtggatgtcgctaac
cgcctgattgactggtgccagtcgcgcggtgaagcggttatcgccagtcaggactggcac
ccggcgaatcacggcagttttgccagtcagcacggtgtagagccttatacgccgggccaa
ctcgacggtttgccacaaaccttctggcccgatcactgtgtgcagaacagtgaaggcgca
caattacatccgttactgaagcaaaaagcgatcgcagcggtgttccataaaggcgaaaat
cctttagttgacagttacagtgccttttttgataacggccgtcggcagaaaactgcgctc
gatgactggttgcgcgctcatgtaatcaatgaattgatcgttatgggtctggctactgac
tattgcgttaagtttaccgtgctggacgcgttacagttaggctataaggtgaacgtgatt
accgatggttgtcgtggcgtaaatatccagccacaggacagtgcgcacgcgtttatggag
atgtcagcagctggggcaacgctatatacgctggcagactgggaagaaacgcaggagtaa

DBGET integrated database retrieval system