KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2185Help
Entry
c2185             CDS       T00106                                 

Gene name
yeaD
Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    c2185 (yeaD)
Enzymes [BR:ecc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     c2185 (yeaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2021059..2021964
Genome map
AA seq 301 aa AA seqDB search
MKLKDCVMIKKIFALPVIEQISPVLSRRKLDELDLIVVDHPQVKASFALQGAHLLSWKPA
GEEEVLWLSNNTPFKNGVAIRGGIPLCWPWFGPAAQQGLPAHGFARNLPWTLKSHREDAD
GVVLTFELTQSEETKKFWPHDFTLLAHFHVGKTCEIDLEAHGEFETTSALHTYFNVGDIA
KVSVSGLGDRFIDKVNDAKEDVLTDGIQTFPDRTDRVYLNPQDCSVINDEALNRIIAVGH
QHHLNVVGWNPGPALSVSMGDMPDDGYKTFVCVETAYASETQKVTKEKPAHLAQSIRVAK
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaaaggactgcgtcatgattaagaaaatttttgcccttccggtcatcgaacaa
atctcccctgtcctctcccgtcgtaaactggatgaactggacctcattgtggtcgatcat
ccccaggtaaaagcctcttttgcattacagggcgcacaccttctctcgtggaaacctgcg
ggtgaagaagaagttctgtggttaagtaacaacacaccgttcaaaaatggcgtcgccatt
cgcggtggcataccgctttgctggccgtggtttggtccggctgcacaacaaggtctgcct
gcgcacggttttgcccgcaacctgccgtggacgctgaaatcacatcgtgaagatgctgat
ggtgtagtgctaacttttgaattgacacaaagcgaagagacgaaaaaattctggccgcac
gactttacgctgttagcgcatttccacgtgggtaaaacctgtgaaatcgatcttgaagca
cacggcgaatttgaaactacctctgctctgcatacctactttaacgtgggtgatatcgct
aaggtaagcgtcagtggactaggcgatcgcttcattgataaagtaaatgacgcgaaagaa
gatgtactgaccgacggtattcagaccttccctgaccgtaccgatcgcgtgtatctgaat
ccgcaagattgcagcgtaattaatgacgaagcgctgaatcgtattatcgccgtaggccac
cagcatcatctgaacgttgtaggctggaacccaggaccggcgctttcagttagcatgggc
gatatgccggatgatggctacaagacctttgtttgtgtagaaacggcttacgcttcagaa
acgcaaaaagtcaccaaagagaaacctgcacatctggcgcaatccattcgcgttgcgaaa
cgttaa

DBGET integrated database retrieval system