KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2275Help
Entry
c2275             CDS       T00106                                 

Gene name
ruvA
Definition
(GenBank) Holliday junction DNA helicase ruvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    c2275 (ruvA)
Enzymes [BR:ecc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     c2275 (ruvA)
DNA repair and recombination proteins [BR:ecc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     c2275 (ruvA)
    RecFOR pathway proteins
     c2275 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2097042..2097653)
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGIIIEKQPPLVLIEVGGVGYEVHMPMTCFYELPEAGQEAIVFTHFVVREDAQLL
YGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVNAVEREEVGALVKLPGIGKKT
AERLIVEMKDRFKGLHGDLFTPAADLVLTSPASPATDDAEQEAVAALVALGYKPQEASRM
VSKIARPDASSETLIREALRAAL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactcagaggcatcatcattgaaaaacaacccccgctggtgttaattgaa
gtgggcggcgtaggctatgaagtgcatatgccgatgacctgtttttatgaactccctgaa
gcgggtcaggaagcgatcgttttcacccactttgtggtgcgtgaagacgcgcaactgctg
tacggttttaacaataaacaagagcgcacgttgttcaaagagttgatcaaaaccaacggc
gtcggcccgaagttggcgctggcgatcctctccggaatgtcagcgcagcagttcgttaat
gccgttgagcgtgaagaagtgggggcactggtgaaactgccgggtattggcaaaaaaacc
gccgaacgcttgattgtcgaaatgaaagaccgatttaaaggtttgcatggcgatctcttt
acgccagccgccgacctggtactcacgtctcctgccagcccggcgaccgacgatgctgaa
caggaagcggttgctgcgctggtggcactgggctataaaccacaagaagcaagccgcatg
gtgagcaaaatcgctcgccctgacgccagcagtgaaacattaattcgcgaagccctacgc
gccgcgttatga

DBGET integrated database retrieval system