KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2886Help
Entry
c2886             CDS       T00106                                 

Definition
(GenBank) Putative fatty oxidation complex alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00071  Fatty acid degradation
ecc00280  Valine, leucine and isoleucine degradation
ecc00281  Geraniol degradation
ecc00310  Lysine degradation
ecc00362  Benzoate degradation
ecc00380  Tryptophan metabolism
ecc00410  beta-Alanine metabolism
ecc00640  Propanoate metabolism
ecc00650  Butanoate metabolism
ecc00903  Limonene and pinene degradation
ecc00930  Caprolactam degradation
ecc01040  Biosynthesis of unsaturated fatty acids
ecc01100  Metabolic pathways
ecc01110  Biosynthesis of secondary metabolites
ecc01120  Microbial metabolism in diverse environments
ecc01130  Biosynthesis of antibiotics
ecc01200  Carbon metabolism
ecc01212  Fatty acid metabolism
Module
ecc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    c2886
   00650 Butanoate metabolism
    c2886
  Lipid metabolism
   00071 Fatty acid degradation
    c2886
   01040 Biosynthesis of unsaturated fatty acids
    c2886
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    c2886
   00310 Lysine degradation
    c2886
   00380 Tryptophan metabolism
    c2886
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    c2886
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    c2886
   00281 Geraniol degradation
    c2886
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    c2886
   00930 Caprolactam degradation
    c2886
Enzymes [BR:ecc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     c2886
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     c2886
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     c2886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AAN81336
UniProt: Q8FFG4
Position
complement(2738976..2741120)
Genome map
AA seq 714 aa AA seqDB search
MEMASAFTLNVRLDNIAVITIDVPGEKMNTLKAEFASQVRAIIKQLRENKDLRGVVFISA
KPDNFIAGADINMIANCKTAQEAEALARQGQQLMAEIHALPVPVIAAIHGACLGGGLELA
LACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQAL
KLGLVDDVVPHSILLEAAVELAKQDRPSSRPLPVRERILAGPLGRALLFKMVGKKTEQKT
QGNYPATKRILDVIETGLAQGTSSGYDAEARAFGELAMTPQSQALRNIFFASTEVKKDPG
SDAPPAPLNSVGILGGGLMGGGIAYVTACKAGLPVRIKDINPQGINHALKYSWDQLEGKV
RRRHLKASERDKQLALISGTTDYRGFAHRDLIIEAVFENLELKQQMVAEVEQNCAAHTIF
ASNTSSLPIADIAAHAARPEQVIGLHFFSPVEKMPLVEIIPHAGTSAQTIATTVKLAKKQ
GKTPIVVRDKAGFYVNRILAPYINEAIRMLTEGERVEHIDAALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGERFSAPANVVSSILNDDRKGRKNGRGFYLYGQKGRKSKKQVDPA
IYPLIGAQGQGRLSAPQVAERCVMLMLNEAVRCLDEQVIRSVRDGDIGAVFGIGFPPFLG
GPFRYIDSLGAGEVVAIMQRLATQYGSRFTPCERLVEMSKRGESFWKTTATDLQ
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggcatcagcgtttacccttaatgtccgtctggacaacattgctgttatcacc
atcgacgtaccgggtgagaaaatgaataccctgaaggcggagtttgcctcgcaggtgcgc
gccattattaaacaactccgcgaaaataaagatctgcgcggtgtggtgtttatctccgcg
aaaccggacaactttatcgctggtgcagacatcaatatgatcgccaactgcaaaacggcg
caagaagcggaagcactggcgcggcagggtcaacagttaatggcggagattcatgctttg
cccgttccggttatcgcggctattcatggcgcttgcctgggcggcgggctggagctggcg
ctggcgtgccacggtcgcgtgtgtactgatgatcctaaaacggtactcggtttgcctgaa
gtacaacttggattgttacccggttcaggcggcacccagcgtttaccgcgcctgataggt
gtcagcacagcattagagatgatcctcaccggaaaacaacttcgggcgaaacaggcatta
aagctggggctggtggatgacgttgttccgcactccattttgctggaagccgctgttgag
ctggcaaagcaggatcgtccatcttcacgccctctacctgtacgcgagcgtattctggcg
gggccgttaggtcgtgcgctgctgttcaaaatggtcggcaagaaaacagagcaaaaaact
cagggtaactatccagcgacgaaacgcattcttgacgttattgaaaccggtttagcgcag
gggaccagcagtggctatgacgccgaagctcgggcgtttggtgaactggcgatgacgccg
caatcacaggcgctgcgcaatatcttttttgccagtacggaagtgaaaaaagatcccggc
agtgatgcgccgcctgcgccattaaacagcgtggggattctaggtggtggcttgatgggc
ggcggtattgcttatgtcactgcttgtaaagcggggcttccggtcagaattaaagatatc
aacccgcagggcataaatcatgcattgaagtacagctgggatcagttggagggcaaagtt
cgccgtcgtcatctcaaagccagcgaacgtgacaaacagctggcattaatctccggaacg
acggactatcgcggctttgcccatcgcgatctgattattgaagcggtgtttgaaaatctc
gaattaaaacaacagatggtggcggaagtggagcaaaattgcgccgctcataccatcttt
gcttcgaatacgtcatctttaccgattgccgatatcgccgctcacgccgcgcgacctgag
caagttattggcctgcatttcttcagtccggtggaaaaaatgccgctggtggagattatt
cctcatgcggggacatcggcgcaaaccatcgctaccacagtaaaactggcgaaaaaacag
ggcaaaacgcccattgtcgtgcgtgacaaagccgggttttacgtcaatcgcattttagcg
ccttacattaatgaagctatccgcatgttgaccgaaggtgaacgggtagagcacattgat
gccgcgctggtgaaatttggttttccggtaggcccaatccaacttttggatgaggtagga
atcgacaccgggactaaaattattcctgtactggaagccgcttatggagaacgttttagc
gcgcctgcaaatgttgtttcttcaattttgaacgacgatcgcaaaggcagaaaaaatggc
cggggtttctatctttatggtcagaaagggcgtaaaagcaaaaaacaggtcgatcccgcc
atttacccgctcattggcgcacaagggcaggggcgactctccgcaccgcaggttgctgaa
cggtgtgtgatgttgatgctgaatgaagcagtacgttgtctggacgagcaggttatccgt
agcgtgcgtgacggggatataggcgcggtatttggcattggttttccgccatttctcggt
ggaccgttccgctatatcgattctctcggcgcaggcgaagtggttgcaataatgcaacga
ctggccacgcagtatggttcccgttttaccccttgcgagcgtttagtcgagatgagcaag
cgtggggaaagtttttggaaaacaactgcaactgacctgcaataa

DBGET integrated database retrieval system