KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2936Help
Entry
c2936             CDS       T00106                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K01885  
glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
Porphyrin and chlorophyll metabolism
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ecc00860]
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:ecc00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2800291..2801706)
Genome map
AA seq 471 aa AA seqDB search
MKIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDG
MNWLSLEWDEGPYYQTKRFDRYNAVIDQMLEEGTAYKCYCSKERLEALREEQMAKGEKPR
YDGRCRHSHEHHADDEPCVVRFANPQEGSVVFDDQIRGPIEFSNQELDDLIIRRTDGSPT
YNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALKAPVPVYAHVSMINGDDGKKLSK
RHGAVSVMQYRDDGYLPEALLNYLVRLGWSHGDQEIFTREEMIKYFTLNAVSKSASAFNT
DKLLWLNHHYINALPPEYVATHLQWHIEQENIDTRNGPQLADLVKLLGERCKTLKEMAQS
CRYFYEDFAEFDADAAKKHLRPVARQPLEVVRDKLTAITDWTAENVHHAIQATADELEVG
MGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALAFIAERENQQ
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaaaactcgcttcgcgccaagcccaacaggctatctgcacgttggcggcgcg
cgtactgctctttactcctggctttttgcacgtaaccacggcggtgagttcgtgctgcgt
attgaagacaccgatcttgagcgttccacgccggaagctatcgaagccattatggatggc
atgaactggctgagcctggagtgggatgaaggtccgtactaccagaccaaacgttttgat
cgctacaacgcggtgatcgatcagatgctggaagagggcacagcttataaatgctattgc
tctaaagagcgcctggaagcgctgcgcgaagagcaaatggcgaaaggtgagaagccgcgt
tatgacggtcgctgccgccacagtcatgagcatcacgctgatgatgagccgtgtgtcgta
cgttttgctaacccgcaggaaggttctgttgtttttgacgatcagatccgtggtccgatc
gagttcagcaaccaggagctggatgatctgattatccgccgtaccgatggttccccaacc
tataacttctgtgtggttgtcgatgactgggatatggaaatcacccacgttatccgtggc
gaagaccatatcaacaacacaccgcgccagattaacattcttaaggctctgaaagcgccg
gtaccggtttacgcgcacgtttctatgatcaacggcgatgacggtaaaaaactgtccaaa
cgtcacggggcggtcagcgtaatgcagtatcgtgatgatggttatctgccagaagcactg
ctgaactatctggtgcgtctgggctggtcccacggcgatcaggaaatcttcactcgtgaa
gagatgattaaatacttcactctgaatgccgtcagcaaatctgccagtgcgttcaacacc
gacaagctgctgtggctgaaccatcactacattaacgcgttgccgccggagtatgttgct
actcacttacagtggcacattgagcaggaaaatatcgatacccgtaacggcccgcagctg
gctgatctggtgaaactgctgggcgaacgctgcaagacgctgaaagagatggcacagagc
tgccgttatttctacgaagattttgctgagttcgatgccgacgccgcgaaaaaacatctg
cgtccggtagcgcgtcagccgctggaagtagttcgtgacaaactgactgcgattactgac
tggaccgctgaaaacgttcatcacgctattcaggcgacggcggatgagctggaagtgggt
atgggtaaagttggtatgccgctgcgtgtcgccgtaaccggtgcggggcagtctccggcg
ctggatgttaccgttcacgcaatcggtaagacccgcagtatcgagcgtatcaacaaagcg
ctggcttttattgctgaacgcgaaaatcagcagtaa

DBGET integrated database retrieval system