KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c3368Help
Entry
c3368             CDS       T00106                                 

Gene name
fucA
Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ecc00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3207908..3208555)
Genome map
AA seq 215 aa AA seqDB search
MERNKLARQIIDTCLEMTRLGLNQGTAGNVSVRYQDGMLITPTGIPYEKLTESHIVFIDG
NGKHEEGKLPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGG
NSIPCAPYATFGTRELSEHVALALKNRKATLLQHHGLIACEANLEKALWLAHEVEVLAQL
YLTTLAITDPVPVLSDEEIAVVLEKFKTYGLRIEE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaacgaaataaacttgctcgtcagattattgacacttgcctggaaatgactcgcctg
gggctgaaccaggggacagcgggtaacgtcagtgtacgttatcaggatgggatgctgatt
acgcctacaggtattccatatgaaaaactgacggagtcgcatattgtctttattgatggc
aacggcaaacatgaggaaggaaaactcccctcaagcgagtggcgtttccatatggcggcc
tatcaaagcagaccggatgccaacgcggttgttcacaatcatgccgttcattgtacggca
gtttccattcttaaccgaccgatccccgcgattcactacatgattgcggcggctggcggt
aattctattccttgcgcgccttatgcgacctttggaacacgcgaactttctgaacatgtt
gcgctggctctcaaaaatcgtaaggcaactttgttacaacatcatgggcttatcgcttgt
gaggcgaatctggagaaagcgttatggctggcgcatgaagttgaagtgctggcacaactt
tacctgacgaccctggcgattacggacccggtgccagtgctgagcgatgaagagattgcc
gtagtgctggagaaattcaaaacctacgggttacggattgaagagtaa

DBGET integrated database retrieval system