KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c3916Help
Entry
c3916             CDS       T00106                                 

Gene name
deaD
Definition
ATP-dependent RNA helicase DeaD
Orthology
K05592  
ATP-dependent RNA helicase DeaD [EC:3.6.4.13]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    c3916 (deaD)
Enzymes [BR:ecc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     c3916 (deaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3739604..3741493)
Genome map
AA seq 629 aa AA seqDB search
MAEFETTFADLGLKAPILEALNDLGYEKPSPIQAECIPHLLNGRDVLGMAQTGSGKTAAF
SLPLLQNLDPELKAPQILVLAPTRELAVQVAEAMTDFSKHMRGVNVVALYGGQRYDVQLR
ALRQGPQIVVGTPGRLLDHLKRGTLDLSKLSGLVLDEADEMLRMGFIEDVETIMAQIPEG
HQTALFSATMPEAIRRITRRFMKEPQEVRIQSSVTTRPDISQSYWTVWGMRKNEALVRFL
EAEDFDAAIIFVRTKNATLEVAEALERNGYNSAALNGDMNQALREQTLERLKDGRLDILI
ATDVAARGLDVERISLVVNYDIPMDSESYVHRIGRTGRAGRAGRALLFVENRERRLLRNI
ERTMKLTIPEVELPNAELLGKRRLEKFAAKVQQQLESSDLDQYRALLSKIQPTAEGEELD
LETLAAALLKMAQGERTLIVPPDAPMRPKREFRDRDDRGPRDRNDRGPRGDREDRPRRER
RDVGDMQLYRIEVGRDDGVEVRHIVGAIANEGDISSRYIGNIKLFASHSTIELPKGMPGE
VLQHFTRTRILNKPMNMQLLGDAQPHTGGERRGGGRGFGGERREGGRNFSGERREGGRGD
GRRFSGERREGRAPRRDDSTGRRRFGGDA
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattcgaaaccacttttgcagatctgggcctgaaggctcctatccttgaagcc
cttaacgatctgggttacgaaaaaccatctccaattcaggcagagtgtattccacatctg
ctgaatggccgcgacgttctgggtatggcccagacggggagcggaaaaactgcagcattc
tctctacctctgctgcagaatcttgatcctgagctgaaagcaccacagattctggtgctg
gcaccgacccgcgaactggcggtacaggttgctgaagcaatgacggatttctctaaacac
atgcgcggcgtaaacgtggttgccctgtacggcggccaacgttatgacgtgcaattacgc
gccctgcgtcaggggccgcagatcgttgtcggtactccgggccgtctgctggaccacctg
aaacgtggcactctggacctctctaaactgagcggtctggttctggatgaagctgacgaa
atgctgcgcatgggcttcatcgaagacgttgaaaccattatggcgcagatcccggaaggt
catcagaccgctctgttctctgcaaccatgccggaagcgattcgtcgcattacccgccgc
tttatgaaagagccgcaggaagtgcgcattcagtccagcgtgactacccgtcctgacatc
agccagagctactggactgtctggggtatgcgtaaaaacgaagcactggtacgtttcctg
gaagcggaagattttgatgcggcgattatcttcgttcgtaccaaaaacgcgactctggaa
gtggcagaagctcttgagcgtaacggctacaacagcgccgcgctgaacggtgacatgaac
caggcgctgcgtgagcagacactggaacgcctgaaagatggtcgtctggacatcctgatt
gcgaccgacgttgcagcccgtggcctggacgttgagcgtatcagcctggtggttaactac
gatatcccgatggattctgagtcttacgttcaccgtatcggtcgtaccggtcgtgcaggt
cgtgctggtcgtgcactgctgttcgttgagaaccgtgagcgtcgtctgctgcgtaacatt
gaacgcaccatgaagctgaccattccggaagtagaactgccgaacgcagaactgctgggc
aaacgtcgtctggaaaaatttgccgctaaagtacagcagcagctggaaagcagcgatctg
gatcaataccgtgcactgctgagcaaaattcagccgactgccgaaggtgaagagctggat
ctcgaaactctggcagccgcactactgaaaatggcacagggtgaacgtactctgattgtt
ccgccagatgcgccgatgcgtccgaaacgtgaattccgtgaccgtgatgaccgtggtccg
cgcgatcgtaacgaccgtggcccgcgtggcgaccgtgaagatcgtccgcgtcgcgaacgt
cgtgatgttggcgatatgcagttgtaccgtattgaagtgggccgcgatgatggtgttgaa
gttcgtcatatcgttggtgcgattgctaacgaaggcgacatcagcagccgttacatcggt
aacatcaagctgtttgcttctcactccaccatcgaactgccgaaaggtatgccgggtgaa
gtgctgcaacactttacgcgtactcgcattctcaacaagccgatgaacatgcagttactg
ggcgatgcacagccgcatactggcggtgagcgtcgtggcggtggtcgtggtttcggtggc
gaacgtcgtgaaggcggtcgtaacttcagcggtgaacgccgtgaaggggggcgtggtgat
gggcgtcgttttagcggcgaacgtcgtgaaggccgcgcaccgcgtcgtgatgactctacc
ggtcgtcgtcgtttcggtggtgatgcgtaa

DBGET integrated database retrieval system