KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c3916Help
Entry
c3916             CDS       T00106                                 

Gene name
deaD
Definition
ATP-dependent RNA helicase DeaD
Orthology
K05592  
ATP-dependent RNA helicase DeaD [EC:3.6.4.13]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    c3916 (deaD)
Enzymes [BR:ecc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     c3916 (deaD)
Messenger RNA biogenesis [BR:ecc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     c3916 (deaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3739604..3741493)
Genome map
AA seq 629 aa AA seqDB search
MAEFETTFADLGLKAPILEALNDLGYEKPSPIQAECIPHLLNGRDVLGMAQTGSGKTAAF
SLPLLQNLDPELKAPQILVLAPTRELAVQVAEAMTDFSKHMRGVNVVALYGGQRYDVQLR
ALRQGPQIVVGTPGRLLDHLKRGTLDLSKLSGLVLDEADEMLRMGFIEDVETIMAQIPEG
HQTALFSATMPEAIRRITRRFMKEPQEVRIQSSVTTRPDISQSYWTVWGMRKNEALVRFL
EAEDFDAAIIFVRTKNATLEVAEALERNGYNSAALNGDMNQALREQTLERLKDGRLDILI
ATDVAARGLDVERISLVVNYDIPMDSESYVHRIGRTGRAGRAGRALLFVENRERRLLRNI
ERTMKLTIPEVELPNAELLGKRRLEKFAAKVQQQLESSDLDQYRALLSKIQPTAEGEELD
LETLAAALLKMAQGERTLIVPPDAPMRPKREFRDRDDRGPRDRNDRGPRGDREDRPRRER
RDVGDMQLYRIEVGRDDGVEVRHIVGAIANEGDISSRYIGNIKLFASHSTIELPKGMPGE
VLQHFTRTRILNKPMNMQLLGDAQPHTGGERRGGGRGFGGERREGGRNFSGERREGGRGD
GRRFSGERREGRAPRRDDSTGRRRFGGDA
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattcgaaaccacttttgcagatctgggcctgaaggctcctatccttgaagcc
cttaacgatctgggttacgaaaaaccatctccaattcaggcagagtgtattccacatctg
ctgaatggccgcgacgttctgggtatggcccagacggggagcggaaaaactgcagcattc
tctctacctctgctgcagaatcttgatcctgagctgaaagcaccacagattctggtgctg
gcaccgacccgcgaactggcggtacaggttgctgaagcaatgacggatttctctaaacac
atgcgcggcgtaaacgtggttgccctgtacggcggccaacgttatgacgtgcaattacgc
gccctgcgtcaggggccgcagatcgttgtcggtactccgggccgtctgctggaccacctg
aaacgtggcactctggacctctctaaactgagcggtctggttctggatgaagctgacgaa
atgctgcgcatgggcttcatcgaagacgttgaaaccattatggcgcagatcccggaaggt
catcagaccgctctgttctctgcaaccatgccggaagcgattcgtcgcattacccgccgc
tttatgaaagagccgcaggaagtgcgcattcagtccagcgtgactacccgtcctgacatc
agccagagctactggactgtctggggtatgcgtaaaaacgaagcactggtacgtttcctg
gaagcggaagattttgatgcggcgattatcttcgttcgtaccaaaaacgcgactctggaa
gtggcagaagctcttgagcgtaacggctacaacagcgccgcgctgaacggtgacatgaac
caggcgctgcgtgagcagacactggaacgcctgaaagatggtcgtctggacatcctgatt
gcgaccgacgttgcagcccgtggcctggacgttgagcgtatcagcctggtggttaactac
gatatcccgatggattctgagtcttacgttcaccgtatcggtcgtaccggtcgtgcaggt
cgtgctggtcgtgcactgctgttcgttgagaaccgtgagcgtcgtctgctgcgtaacatt
gaacgcaccatgaagctgaccattccggaagtagaactgccgaacgcagaactgctgggc
aaacgtcgtctggaaaaatttgccgctaaagtacagcagcagctggaaagcagcgatctg
gatcaataccgtgcactgctgagcaaaattcagccgactgccgaaggtgaagagctggat
ctcgaaactctggcagccgcactactgaaaatggcacagggtgaacgtactctgattgtt
ccgccagatgcgccgatgcgtccgaaacgtgaattccgtgaccgtgatgaccgtggtccg
cgcgatcgtaacgaccgtggcccgcgtggcgaccgtgaagatcgtccgcgtcgcgaacgt
cgtgatgttggcgatatgcagttgtaccgtattgaagtgggccgcgatgatggtgttgaa
gttcgtcatatcgttggtgcgattgctaacgaaggcgacatcagcagccgttacatcggt
aacatcaagctgtttgcttctcactccaccatcgaactgccgaaaggtatgccgggtgaa
gtgctgcaacactttacgcgtactcgcattctcaacaagccgatgaacatgcagttactg
ggcgatgcacagccgcatactggcggtgagcgtcgtggcggtggtcgtggtttcggtggc
gaacgtcgtgaaggcggtcgtaacttcagcggtgaacgccgtgaaggggggcgtggtgat
gggcgtcgttttagcggcgaacgtcgtgaaggccgcgcaccgcgtcgtgatgactctacc
ggtcgtcgtcgtttcggtggtgatgcgtaa

DBGET integrated database retrieval system