KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c3933Help
Entry
c3933             CDS       T00106                                 

Gene name
folP
Definition
(GenBank) Dihydropteroate synthase (EC:2.5.1.15)
  KO
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    c3933 (folP)
Enzymes [BR:ecc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     c3933 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3757694..3758608)
Genome map
AA seq 304 aa AA seqDB search
MYRKPRGVLRGFFLSIHTRDNTMKLFAQGTSLDLSHPHVMGILNVTPDSFSDGGTHNSLI
DAVKHANLMINAGATIIDVGGESTRPGAAEVSVEEELQRVIPVVEAIAQRFEVWISVDTS
KPEVIRESAKVGAHIINDIRSLSEPGALEAAAETGLPVCLMHMQGNPKTMQEAPKYDDVF
AEVNRYFIEQIARCEQAGIAKEKLLLDPGFGFGKNLSHNYSLLARLAEFHHFNLPLLVGM
SRKSMIGQLLNVGPSERLSGSLACAVIAAMQGAHIIRVHDVKETVEAMRVVEATLSAKEN
KRYE
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
ttgtaccgaaaaccccggggcgtgctccggggttttttcttatcaattcataccagggat
aacaccatgaaactctttgcccagggcacttcactggaccttagccatcctcacgtaatg
gggatcctcaacgtcacgcctgattccttttcggatggcggtacgcataactcgctgata
gatgcggtgaaacatgcgaatctgatgatcaacgctggcgcgacgatcattgacgttggt
ggcgagtccacgcgcccaggagcggcggaagttagcgttgaagaagagttgcaacgtgtt
attcctgtggttgaggcaattgctcaacgcttcgaagtctggatctcggtcgatacatcc
aaaccagaagtcatccgtgagtcagcgaaagttggcgctcacattattaacgatatccgc
tccctttccgaaccaggggctctggaggcagctgcagaaaccggtttaccggtttgtctg
atgcatatgcagggaaatccaaagaccatgcaggaagccccgaagtatgacgatgtcttt
gcagaagtgaatcgctattttattgagcaaatagcacgttgcgagcaggcgggtatcgca
aaagagaaattgttgctcgaccccggattcggtttcggtaaaaatctctcccataactat
tcattactggcgcgcctggctgaatttcaccatttcaacctgccgctgttggtgggtatg
tcacgaaaatcgatgattgggcagctgctgaacgtggggccgtccgagcgtctgagcggt
agtctggcttgtgcggtcattgccgctatgcaaggcgcgcatatcattcgtgttcatgac
gtcaaagaaaccgtagaagcgatgcgggtggtggaagccactctgtctgcaaaggaaaac
aaacgctatgagtaa

DBGET integrated database retrieval system