KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c4109Help
Entry
c4109             CDS       T00106                                 

Gene name
chiA
Definition
secreted endochitinase
Orthology
K13381  
bifunctional chitinase/lysozyme [EC:3.2.1.14 3.2.1.17]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    c4109 (chiA)
Enzymes [BR:ecc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     c4109 (chiA)
    3.2.1.17  lysozyme
     c4109 (chiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3898539..3901241)
Genome map
AA seq 900 aa AA seqDB search
MKLNIFTKSMIGMGLVCSALPALAMEAWNNQQGGNKYQVIFDGKIYENAWWVSSTNCPGK
AKANDATNPWRLKRTATAAEISQFGNTLSCEKSGSSSSSNSNTPASNTPANGGSATPAQG
TVPSNSSVVAWNKQQGGQTWYVVFNGAVYKNAWWVASSNCPGDAKGNDASNPWRYVRAAT
ATEISETSNPQSCTSAPQPAPDVKPAPDVKPAPDVQPAPADKSNDNYAVVAWKGQEGSST
WYVIYNGGIYKNAWWVGAANCPGDAKENDASNPWRYVRAATATEITQYGNPGSCSVKPDN
NGGAVTPVDPTPETPETPVTPTPDNNEPSTPADSSNDYSLQAWSGQEGSEIYHVIFNGNV
YQNAWWVGSEDCPRGTSVENSNNPWRLVRTATAAEMSQYGNPTTCEIDNGGVIIANGFQA
SKAYSANSIVDYNDAHYKTSVDQDAWGFVPGGDNPWKKYEPAKAWSASTVYVKGDRVVVD
GQAYEALFWTQSDNPALVANQNATGSNSRPWKPLGKTQSYSNEELNNAPQFNPETLYASD
TLIRFNGENYISQSKVQKVSPSDSNPWRVFVDWTGTKERVGTPKKAWPKHVYAPYVDFTL
NTIPDLAALAKNHNVNHFTLAFVVSKDANTCLPTWGTAYGMQNYAQYSKIKALREAGGDV
MLSIGGANNAPLAASCKNVDDLMQHYYDIVDNLNLRVLDFDIEGTWVADQASIERRNLAV
KKVQDKWKSEGKDIAIWYTLPILPTGLTPEGMNVLSDAKAKGVELAGVNVMTMDYGNAIC
QSANTEGQNIHGKCATSAIANLHSQLKGLHPNKSDAEIDAMMGTTPMVGVNDVQGEVFYL
SDARLVMQDAQKRNLGMVGIWSIARDLPGGTNLSPEFHGLTKEQAPKYAFSEIFAPFTKQ
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaatatatttactaaatctatgattggtatggggctggtgtgttccgctctg
ccagcattggcaatggaagcatggaataaccaacaaggtggtaataaatatcaggttatt
ttcgatggcaaaatttatgaaaatgcctggtgggtttcttctacaaattgcccgggaaaa
gcgaaagcaaatgatgcaactaacccgtggcgtttaaagcgtaccgcaacagctgctgaa
attagtcagtttggcaatacactttcctgcgaaaagagcggcagctcatcttcttcaaat
tcaaatacgccagcatctaatacgcctgctaatggcggttcggctacaccagcacagggc
actgttccgtctaattcttctgtagttgcctggaataaacagcagggcggtcaaacctgg
tatgtcgtctttaatggtgcggtatataaaaatgcctggtgggtagcctcttctaactgc
ccgggtgatgcgaaaggcaatgatgccagcaacccatggcgttatgttcgtgccgctacg
gcaacggaaatctcagaaaccagtaatccacagtcttgtacttcagcaccacagcctgca
ccggatgtgaaaccggcaccggacgttaaaccggctcctgatgttcagccagccccagct
gataagtcaaacgacaactatgctgtcgtagcctggaaaggtcaggaaggttcttctaca
tggtacgttatctacaacggcggcatttataagaatgcctggtgggtgggcgcggcaaat
tgcccaggcgatgcgaaagaaaacgatgccagcaacccatggcgttatgttcgcgcggca
acggcaacagaaatcactcagtatggtaacccaggctcctgttccgttaagccggataat
aatggcggtgctgtgactccggttgatccaactccggaaacaccggaaactccagttact
ccaactccggataacaacgagccatcaacaccagcggatagcagtaacgattactcactg
caggcgtggagtggccaggaaggcagcgaaatttaccatgttatcttcaatggtaatgtt
tatcagaatgcctggtgggttggttctgaagattgcccgcgtggcaccagtgtagaaaac
tccaataacccatggcgcctcgtgcgtacagctaccgctgcggaaatgagtcagtacggt
aacccgactacctgtgaaattgataatggcggcgtcattattgcgaatggtttccaggcc
agcaaagcgtacagcgcgaacagcatcgtagattataacgatgcacattataaaacctct
gtcgatcaagacgcatggggctttgtccccggcggcgataacccgtggaagaaatacgaa
ccggcgaaagcatggtccgcttccaccgtgtacgtgaaaggtgatcgcgttgttgttgat
gggcaggcttatgaagcgctgttctggacgcaaagtgacaaccctgctctggttgcgaac
caaaacgccaccggtagcaatagtcgcccgtggaagccgttaggtaagactcagagctat
agcaacgaagagctgaataatgcgccgcagtttaatccagaaacgctttatgccagtgat
acgctgattcgctttaacggtgagaactacatttctcagagtaaagtgcagaaagtttct
ccttctgacagcaacccgtggcgtgtttttgttgactggaccggaaccaaagagcgcgta
ggtacgccgaagaaagcgtggccgaaacacgtttatgcaccgtatgtcgactttacgctg
aatacgatcccggatttggctgcgctggctaagaatcataacgtcaaccacttcacgctg
gcgtttgtggtgagtaaagatgcgaacacctgtctaccgacatggggtaccgcttacggt
atgcagaattacgctcagtacagcaaaatcaaagctctgcgtgaggctggcggtgatgtg
atgctgtctatcggtggtgctaataatgccccgctggcagcttcctgtaagaacgttgac
gatctaatgcagcattattatgacatcgttgataacctgaacctcagagtcctggacttc
gatatcgaaggcacctgggttgcggatcaggcatctattgaacgtcgtaaccttgctgtg
aagaaagtgcaggataaatggaagtcagagggcaaagatattgctatctggtacaccttg
ccaattctgccgactggcctgacgccggaagggatgaatgtcctgagcgatgccaaagcg
aaaggtgttgagctggcgggtgtgaacgtgatgacaatggactacggtaacgcgatttgt
cagtctgcaaataccgaaggccagaacattcacggtaagtgtgcaacgtctgcgattgcc
aacctgcattcacaattgaaaggcctccatcccaacaagagcgatgcagaaattgacgct
atgatgggtaccacgccgatggttggcgtgaacgacgttcagggcgaggtgttctatctc
tctgatgctcgtctggtcatgcaggatgcgcagaagcgtaatctcggtatggttggtatc
tggtcaatcgcgcgcgacctgccaggcggcactaacctgtctccggaattccacggcctg
actaaagaacaggcaccgaagtacgcatttagcgaaatcttcgcgccgtttactaagcaa
taa

DBGET integrated database retrieval system