KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c4343Help
Entry
c4343             CDS       T00106                                 

Gene name
yhjM
Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ecc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4127878..4128990)
Genome map
AA seq 370 aa AA seqDB search
MKMNVLRSGLVTMLLLAAFSVQAACTWPAWEQFKKDYISQEGRVIDPSDARKITTSEGQS
YGMFFALAANDRAAFDNLLDWTQNNLAQGSLKEHLPAWLWGKKENSKWEVLDSNSASDGD
VWMAWSLLEAGRLWKEQRYTDIGSALLKRIAREEVVTVPGLGSMLLPGKVGFAEDNSWRF
NPSYLPPTLAQYFTRFGAPWTTLRETNQRLLLETAPKGFSPDWVRYEKDKGWQLKAEKTL
ISSYDAIRVYMWVGMMPDSDPQKARMLNRFKPMATFTEKNGYPPEKVDVATGKAQGKGPV
GFSAAMLPFLQNRDAQAVQRQRVADNFPGSDAYYNYVLTLFGQGWDQHRFRFSTKGELLP
DWGQECANSH
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
ttgaagatgaatgtgttgcgtagtggactcgtgacgatgctgctgctggctgcctttagt
gttcaggcagcctgtacctggcctgcctgggagcagtttaaaaaggattacatcagtcag
gaagggcgcgtcatcgaccccagcgacgcgcgcaaaatcaccacctccgaagggcaaagt
tacggcatgttctttgccctggcggctaacgaccgtgcagctttcgataatcttctcgac
tggacgcagaacaatctcgctcagggttctttaaaagaacatttgcccgcctggctgtgg
ggcaagaaagagaacagtaagtgggaagtgctggacagcaattcggcctccgatggtgat
gtctggatggcctggtcgttgctggaggcggggcgtttgtggaaagagcagcgttatacc
gacatcggcagcgcattgctaaaacgtatcgcgcgggaggaagtggtgacggtgcctggg
ctgggctccatgttgttaccgggcaaagtgggttttgctgaggataacagctggcgtttt
aaccccagctacctgccgccgacgctggcgcagtatttcacccgctttggcgcgccgtgg
accacgctgcgcgaaaccaatcaacgtttattgctggaaaccgccccgaaaggcttttcg
ccagactgggtgcgctatgagaaagacaaaggctggcagctaaaagccgaaaaaacattg
atcagcagctacgacgctatccgcgtttacatgtgggtaggcatgatgcctgacagcgat
ccgcaaaaagcgcggatgctcaaccggtttaaaccgatggcgacattcactgagaaaaac
ggttatccgccggaaaaagtggatgtggctacggggaaagcgcagggtaaaggaccggtc
ggtttttctgccgccatgctgccctttttacaaaaccgcgatgcgcaggccgttcagcgc
cagcgcgtggccgataactttcccggcagcgatgcctattacaactatgtgctgaccctg
tttggacaaggctgggatcaacaccgtttccgcttctcgacaaaaggtgagttattacct
gactggggccaggaatgcgcaaattcacactaa

DBGET integrated database retrieval system