KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c4631Help
Entry
c4631             CDS       T00106                                 

Gene name
tnaA
Definition
tryptophanase (EC:4.1.99.1)
Orthology
K01667  
tryptophanase [EC:4.1.99.1]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    c4631 (tnaA)
Enzymes [BR:ecc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.1  tryptophanase
     c4631 (tnaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4390451..4391881
Genome map
AA seq 476 aa AA seqDB search
MKDYVMENFKHLPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFIDLLTDSG
TGAVTQSMQAAMMRGDEAYSGSRSYYALAESVKNIFGYQYTIPTHQGRGAEQIYIPVLIK
KREQEKGLDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRYDFKGNFDLEG
LERGIEEVGPNNVPYIVATITSNSAGGQPVSLANLKVMYSIAKKYDIPVVMDSARFAENA
YFIKQREAEYKDWTIEQITRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFDVYTECR
TLCVVQEGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIGVVCQQA
GGHAAFVDAGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTGKQLPCPA
ELLRLTIPRATYTQTHMDFIIEAFKHVKENAANIKGLTFTYEPKVLRHFTAKLKEV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaaggattatgtaatggaaaactttaaacatctccctgaaccgttccgcattcgtgtt
attgagccagtaaaacgtaccactcgcgcttatcgtgaagaggcaattattaaatccggc
atgaacccgttcctgctggatagcgaagatgtgtttatcgatttactgaccgacagcggc
accggggcggtgacgcagagtatgcaggccgcgatgatgcgcggcgacgaagcttacagc
ggcagccgcagctactacgcgttagccgagtcagtgaaaaatatctttggttatcaatac
actattccgactcaccagggccgtggtgcagagcaaatctatattccggtactgattaaa
aaacgcgagcaggaaaaaggcctggatcgcagcaaaatggtggcgttctctaactatttc
tttgataccacgcagggccatagccagattaacggctgtaccgtgcgtaacgtctatatc
aaagaagccttcgatactggcgtgcgttacgactttaaaggcaactttgaccttgaggga
ttagaacgcggtattgaagaagttggcccgaataacgtgccgtatatcgttgcaaccatc
accagtaactccgcaggtggtcagccggtttcactggcaaacttaaaagtgatgtacagc
atcgcgaagaaatacgatattccggtggtcatggactccgcacgctttgccgaaaacgcc
tatttcatcaagcagcgtgaagcagaatacaaagactggaccatcgagcagatcacccgc
gaaacctacaaatatgccgatatgctggcgatgtccgccaagaaagatgcgatggtgccg
atgggcggcctgctgtgcatgaaagacgacagcttctttgatgtgtataccgaatgcaga
accctttgcgtggtgcaggaaggcttcccgacatatggcggcctggaaggcggcgctatg
gagcgtctggcggtaggtctgtatgacggcatgaatctggactggctggcttatcgtatc
gcacaggtgcagtatctggtcgatggtctggaagagattggcgttgtctgtcagcaggcg
ggcggtcacgcggcattcgttgatgcaggtaaactgttgccgcatatcccggcagatcag
ttcccggcacaggcgctggcctgcgagctgtataaagtcgccggtatccgtgcggtagaa
attggctctttcctgttaggccgcgatccgaaaaccggtaaacaactgccatgcccggct
gaactgctgcgtttaaccattccgcgcgcaacatatactcaaacacatatggacttcatt
attgaagcctttaaacatgtgaaagagaacgcggcgaatattaaagggttaacctttacc
tacgaaccgaaagtattgcgtcacttcaccgcaaaactgaaagaagtttaa

DBGET integrated database retrieval system