KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c4674Help
Entry
c4674             CDS       T00106                                 

Gene name
yieN
Definition
regulatory ATPase RavA
Orthology
K03924  
MoxR-like ATPase [EC:3.6.3.-]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4430630..4432126)
Genome map
AA seq 498 aa AA seqDB search
MAHPHLLAERISRLSSSLEKGLYERSHAIRLCLLAALSGESVFLLGPPGIAKSLIARRLK
FAFQNARAFEYLMTRFSTPEEVFGPLSIQALKDEGRYERLTSGYLPEAEIVFLDEIWKAG
PAILNTLLTAINERQFRNGALVEKIPMRLLVAASNELPEADSSLEALYDRMLIRLWLDKV
QDKANFRSMLTSQQDENDNPVPASLQITDEEYERWQKEIGEITLPDHVFELIFMLRQQLD
KLPDAPYVSDRRWKKAIRLLQASAFFSGRSAVAPVDLILLKDCLWYDAQSLNLIQQQIDV
LMTGHAWQQQGMLTRLGAIVQRHLQLQQQQSDKTALTVIRLGGIFSRRQQYQLPVNVTAS
TLTLLLQKPLKLHDMEVVHISFERSALEQWLSKGGEIRGKLNGIGFAQKLNLEVDSAQHL
VVRDVSLQGSTLALPGSLAEGLPGEIKQQLEELESDWRKQHALFSEQQKCLFIPGDWLGR
IEASLQDVGAQIRQAQQC
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggctcaccctcatttattagcggaaagaatttcccgcctgagcagttcgttggaaaag
gggctttatgaacgtagccacgccatccgcttgtgtttattagcggcattaagtggtgaa
agtgtgttcctccttggcccgccaggtattgccaaaagtttgatcgcccggcgcttaaaa
ttcgcctttcagaatgcccgcgcgtttgaatatctgatgacccgcttctccacgccggaa
gaagtttttggtcccctttctattcaggcgctaaaagatgaagggcgctatgaacgttta
accagcggttacctgccggaagctgaaatcgtctttctggatgagatctggaaagcgggt
ccggcaattcttaataccctgctcaccgccattaacgagcgccagttccgcaacggcgca
ctcgtagaaaaaatcccgatgcgtctgctggtggcggcctccaacgagctgccggaagca
gacagcagtctggaagcgttatatgatcgcatgctgattcgtctgtggttagataaagtg
caggataaagcgaatttccgctccatgctgaccagtcaacaggatgaaaatgacaatccg
gttcctgcctccttgcagatcacagatgaagaatatgaacgctggcagaaagagattggt
gaaattacgctgcccgatcatgtatttgagctgatttttatgctgcgccagcaactggat
aaattaccggatgcgccttatgtctcggatcgtcgctggaaaaaagcgatccgcttattg
caggccagcgccttttttagcggtcgcagtgctgtcgccccggttgatctcattttgctg
aaagattgcctgtggtatgacgcgcaaagcctgaatttgatacaacaacaaattgatgta
ttgatgaccggtcacgcctggcaacagcaagggatgttgacccgcctgggcgcgattgtg
caacgtcacctgcaacttcagcagcaacaaagcgataaaacagccttaacggtaattcgt
ctgggcggcatttttagccgtcgtcagcagtatcaactccctgttaacgttactgcttcc
actctgactctgctgctgcaaaaaccgttaaaattgcatgatatggaagtggttcatatc
tcctttgagcgtagcgcgctggaacagtggctgagtaaaggtggtgagattcgcggcaaa
ctgaacggtatcggctttgcccagaaactgaatctggaagtcgatagcgcccaacatctt
gttgtacgcgatgtaagtttacaaggcagtacgctagcacttcccggttcattggctgaa
ggtctgccaggtgaaataaaacaacaactggaagagcttgaaagcgactggcgcaagcaa
cacgctttattcagcgaacagcaaaaatgtctgtttatccctggcgactggttaggtcgc
attgaagccagcctacaggatgtcggcgcacagattcgccaggcacaacaatgctaa

DBGET integrated database retrieval system