KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c4680Help
Entry
c4680             CDS       T00106                                 

Gene name
rbsK
Definition
(GenBank) Ribokinase (EC:2.7.1.15)
  KO
K00852  
ribokinase [EC:2.7.1.15]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    c4680 (rbsK)
Enzymes [BR:ecc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     c4680 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
4438300..4439256
Genome map
AA seq 318 aa AA seqDB search
MAHFMDIPNMQNAGSLVVLGSINADHILNLQSFPTPGETVTGNHYQVAFGGKGANQAVAA
GRSGANIAFIACTGDDSIGESVRQQLATDNIDISPVSVIKGESTGVALIFVNGEGENVIG
IHAGANAALSPALVEAQRERIANASALLMQLESPLESVMAAAKIAHQNKTIVALNPAPAR
ELPDELLALVDIITPNETEAEKLTGIRVENDEDAAKAAQVLHEKGIRTVLITLGSRGVWA
SVNGEGQRVPGFRVQAVDTIAAGDTFNGALITALLEEKPLPEAIRFAHAAAAIAVTRKGA
QPSVPWREEIDAFLDRQR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcattttatggacatcccgaatatgcaaaacgcaggcagcctcgttgttcttggc
agcattaatgctgaccacattcttaatcttcaatcttttcctactccaggcgaaaccgta
accggtaaccactatcaggttgcatttggcggcaaaggcgcgaatcaggcggtggctgct
gggcgtagcggtgcgaatatcgcgtttattgcctgcactggcgatgacagcattggtgag
agcgttcgccagcagctcgccactgataacatcgatatttctccggtcagcgtgatcaaa
ggcgaatcaacaggtgtggcgctgatttttgttaatggcgaaggtgagaatgtcatcggt
attcatgccggcgctaatgctgccctttccccggcgctggtggaagcgcaacgtgagcgt
attgccaacgcgtcagcattattaatgcagctggaatcaccactcgaaagtgtgatggca
gcggcgaaaatcgcccatcaaaataagactatcgttgcgcttaacccggctccggctcgc
gaacttcctgacgaactgctggcgctggtggacattattacgccaaacgaaacggaagca
gaaaagctcaccggtattcgtgttgaaaatgatgaagatgcagcgaaggcggcgcaggta
ctgcatgaaaaaggtatccgtactgtactgattactttaggaagtcgtggtgtatgggct
agcgtgaatggtgaaggtcagcgcgttcctggattccgggtgcaggctgtcgatactatt
gctgccggagatacctttaacggcgcgttaatcacggcgttgctggaagaaaaaccattg
ccagaggcgattcgttttgcccatgcagccgctgcgattgccgtaacacgtaaaggcgca
caaccttccgtaccgtggcgtgaagagatcgacgcatttttagacaggcagaggtga

DBGET integrated database retrieval system