KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c4867Help
Entry
c4867             CDS       T00106                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase isozyme I
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00010  Glycolysis / Gluconeogenesis
ecc00030  Pentose phosphate pathway
ecc00051  Fructose and mannose metabolism
ecc00052  Galactose metabolism
ecc00680  Methane metabolism
ecc01100  Metabolic pathways
ecc01110  Biosynthesis of secondary metabolites
ecc01120  Microbial metabolism in diverse environments
ecc01130  Biosynthesis of antibiotics
ecc01200  Carbon metabolism
ecc01230  Biosynthesis of amino acids
ecc03018  RNA degradation
Module
ecc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    c4867 (pfkA)
   00030 Pentose phosphate pathway
    c4867 (pfkA)
   00051 Fructose and mannose metabolism
    c4867 (pfkA)
   00052 Galactose metabolism
    c4867 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    c4867 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    c4867 (pfkA)
Enzymes [BR:ecc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     c4867 (pfkA)
Protein phosphatases and associated proteins [BR:ecc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     c4867 (pfkA)
Messenger RNA biogenesis [BR:ecc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     c4867 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AAN83295
UniProt: Q8FBD0
Structure
PDB: 

Jmol
Position
4627114..4628172
Genome map
AA seq 352 aa AA seqDB search
MLYYLHIRWITSMCKKTSGNRFHFAFQSSEVVMIKKIGVLTSGGDAPGMNAAIRGVVRSA
LTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGSARFPEFRDENIRAVAIE
NLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFFTALSTVV
EAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEIKA
GIAKGKKHAIVAITEHMCDVDELAHFIEKETGRETRATVLGHIQRGGSPVPYDRILASRM
GAYAIELLLAGYGGRCVGIQNEQLVHHDIIDAIENMKRPFKGDWLDCAKKLY
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
ttgttatactatttgcacattcgttggatcacttcgatgtgcaagaagacttccggcaac
agatttcattttgcattccaaagttcagaggtagtcatgattaagaaaatcggtgtgttg
acaagcggcggtgatgcgccaggcatgaacgccgcaattcgcggggttgttcgttctgcg
ctgacagaaggtctggaagtaatgggcatttatgacggctatctgggtctgtatgaagac
cgtatggtacagctagaccgttacagcgtttctgacatgatcaaccgtggtggtacgttc
ctcggttctgcgcgtttcccggaattccgcgacgagaacatccgcgccgtggctatcgaa
aacctgaaaaaacgtgggatcgacgcgctggtggttatcggcggtgacggttcctacatg
ggtgcaatgcgtctgaccgaaatgggcttcccgtgcatcggcctgccgggcactatcgac
aacgacatcaaaggcactgactacactatcggtttcttcactgcgctgagcaccgttgta
gaagcgatcgaccgtctgcgtgacacctcttcttctcaccagcgtatttccgtggtggaa
gtgatgggccgttattgtggcgatctgacgttggctgcggctattgccggcggctgtgaa
ttcgttgtggttccggaagttgaattcagccgtgaagacctggtaaacgaaatcaaagcg
ggtatcgcgaaaggtaaaaaacacgcgatcgtggcgattaccgaacatatgtgtgatgtt
gacgaactggcgcatttcatcgagaaagaaaccggtcgtgaaacccgcgcaactgtgctg
ggccacatccagcgcggtggttctccggtgccttacgaccgtattctggcttcccgtatg
ggcgcttacgctatcgagctgctgctggcaggttacggtggtcgttgcgtaggtatccag
aacgaacagctggttcaccacgacatcatcgacgctatcgaaaacatgaagcgtccgttc
aaaggcgactggctggactgcgcgaaaaaactgtattaa

DBGET integrated database retrieval system