KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c4878Help
Entry
c4878             CDS       T00106                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    c4878 (glpK)
Enzymes [BR:ecc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     c4878 (glpK)
Exosome [BR:ecc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   c4878 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4635408..4637021)
Genome map
AA seq 537 aa AA seqDB search
MVAICLAISVLWKKRRPQLLQNKKLRCNMTTGQLNMTEKKYIVALDQGTTSSRAVVMDHD
ANIISVSQREFEQIYPKPGWVEHDPMEIWATQSSTLVEVLAKADISSDQIAAIGITNQRE
TTIVWEKETGKPIYNAIVWQCRRTAEICEHLKRDGMEEYIRNNTGLVIDPYFSGTKVKWI
LDHVEGSRERARRGELLFGTVDTWLIWKMTQGRVHVTDYTNASRTMLFNIHSLDWDDKML
EVLDIPREMLPEVRRSSEVYGQTNIGGKGGTRIPISGIAGDQQAALFGQLCVKEGMAKNT
YGTGCFMLMNTGEKAVKSENGLLTTIACGPTGEVNYALEGAVFMAGASIQWLRDEMKLIN
DAYDSEYFATKVQNTNGVYVVPAFTGLGAPYWDPYARGAIFGLTRGVNANHIIRATLESI
AYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLMQFQSDILGTRVERPEVREVTALGAA
YLAGLAVGFWQNLDELQEKAVIEREFRPGIETTERNYRYAGWKKAVKRAMAWEEHDE
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
ttggtcgccatttgccttgcgatatctgtgttgtggaagaaaaggagaccacaactcctt
cagaacaaaaagcttcgctgtaatatgactacgggacaattaaacatgactgaaaaaaaa
tatatcgttgcgctcgaccagggcaccaccagctcccgcgcggtcgtaatggatcacgat
gccaatatcattagcgtgtcgcagcgcgaatttgagcaaatctacccaaaaccaggctgg
gtagaacacgacccaatggaaatctgggccacccaaagctccacgctggtagaagtgctg
gcgaaagccgatatcagttccgatcagattgcagctatcggtattacgaaccagcgtgaa
accactattgtctgggaaaaagaaaccggcaagcctatctataacgccattgtctggcag
tgccgtcgtaccgcagaaatctgcgaacatctcaaacgcgatggcatggaagagtacatt
cgtaacaacaccggtctggtgattgacccgtacttctctggcaccaaagtgaagtggatc
ctcgaccatgtggaaggctctcgcgagcgtgcgcgtcgtggtgaattgctgtttggtacg
gttgatacgtggcttatctggaaaatgactcagggccgtgtccatgtgaccgattacacc
aacgcctctcgtaccatgttgtttaacatccatagtctggactgggacgacaaaatgctg
gaggtgctggatattccacgcgagatgctgccagaagtgcgtcgttcttccgaagtatac
ggtcagactaacattggcggcaaaggcggcacgcgtattccaatctccgggatcgccggt
gaccagcaggcggcgctgtttggtcagttgtgcgtgaaagaaggaatggcgaagaacacc
tatggcactggctgctttatgctgatgaacactggcgagaaagcggtaaaatcagaaaac
ggcctgctgaccaccatcgcctgcggcccgactggcgaagtgaactatgcgctggaaggt
gcagtgtttatggcgggcgcgtccattcagtggctgcgcgatgagatgaagttgattaac
gacgcctacgattccgaatatttcgccaccaaagtgcaaaacaccaatggtgtgtatgtg
gttccggcctttaccgggctgggtgcgccatactgggatccgtatgcacgcggggcgatt
ttcggtctgactcgtggggtgaacgctaaccacattatacgcgcgacgctggagtctatt
gcttatcagacgcgtgacgtgctggaagcaatgcaggccgactccggtattcgtctgcac
gcgctgcgcgtggacggcggtgcggtggcaaacaatttcctgatgcagttccagtccgat
attctcggtacgcgcgttgagcgcccggaagtgcgcgaagtcaccgctttgggtgcggcc
tatcttgctggtctggcggttggcttctggcagaatcttgacgagctgcaagagaaagcg
gtgattgaacgcgagttccgtcctggcatcgaaaccactgagcgtaattaccgttacgca
ggctggaaaaaagcggtcaaacgcgcgatggcatgggaagaacacgacgagtaa

DBGET integrated database retrieval system