KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c4971Help
Entry
c4971             CDS       T00106                                 

Gene name
aceB
Definition
(GenBank) Malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00620  Pyruvate metabolism
ecc00630  Glyoxylate and dicarboxylate metabolism
ecc01100  Metabolic pathways
ecc01110  Biosynthesis of secondary metabolites
ecc01120  Microbial metabolism in diverse environments
ecc01200  Carbon metabolism
Module
ecc_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    c4971 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    c4971 (aceB)
Enzymes [BR:ecc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     c4971 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI BTV_NS2
Motif
Other DBs
NCBI-ProteinID: AAN83397
UniProt: A0A0H2VFL6
Structure
PDB: 

Jmol
Position
4746647..4748266
Genome map
AA seq 539 aa AA seqDB search
MTRSCTMTEQATTIDELAFTRPYGEQEKQILTAEAVEFLTELVTHFTPQRNKLLAARIQQ
QQDIDNGMLPDFISETASIRYADWKIRGIPSDLEDRRVEITGPVERKMVINALNANVKVF
MADFEDSLAPDWNKVIDGQINLRDAVNGTISYSNEAGKIYQLKPNPAVLICRVRGLHLPE
KHVTWRGETIPGSLFDFALYFFHNYQALLAKGSGPYFYLPKTQSWQEAAWWSEVFSYAED
RFNLPRGTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNYPDRV
LPDRQAVTMDKPFLNAYSRLLIKTCHKRGAFAMGGMAAFIPSKDEERNNQVLDKVKADKS
LEANNGHDGTWIAHPGLADTAMAVFNDILGSRKNQLEVMREQDAPITADQLLAPCAGERT
EEGMRANIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISSTSIWQWIHHQKTLSNGKPV
TKALFRQMLGEEMKVIASELGEERFSHGRFDDAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgacgaggagctgcacgatgactgaacaggcaacaacaatcgatgaactggcttttaca
aggccgtatggcgagcaggagaagcaaattcttactgccgaagcggtagaatttctgact
gagctggtgacgcattttacgccacaacgcaataaacttctggcagcgcgtattcagcag
cagcaggatatcgataacggaatgttgcctgattttatttcggaaacagcttccattcgt
tatgctgactggaaaattcgcgggattccttcggacttagaagatcgtcgcgtagagatt
accggacctgtagagcgcaagatggtgatcaacgcgctcaacgccaatgtgaaagtcttt
atggccgatttcgaagattcactggcaccagactggaacaaagtgatcgatgggcaaatt
aacctgcgcgatgcggttaacggcaccatcagctatagcaatgaagcaggcaaaatttat
cagctcaagcccaatccagcggttttgatttgtcgggtacgcggtctgcacttgccggaa
aaacatgtcacctggcgtggtgagacaatccccggtagcctgtttgattttgcgctctat
ttcttccacaactatcaggcactgttggcaaagggcagcggtccctatttctatctgccg
aaaacccagtcctggcaggaagcggcctggtggagcgaagtcttcagctatgcagaagat
cgctttaatctgccgcgcggcaccatcaaggcgacgttgctgattgaaacgctgcccgcc
gtgttccagatggatgaaatccttcacgcgctgcgtgaccatattgttggtctgaactgc
ggtcgttgggattacatcttcagttatatcaaaacattgaaaaactatcccgatcgcgtc
ctgccagacagacaggcagtgacgatggataaacccttcctgaatgcttactcacgcctg
ttgattaaaacctgccataaacgcggtgcttttgcgatgggcggcatggcggcgtttatt
ccgagcaaagatgaagagcgcaataaccaggtgctcgacaaagtaaaagcggataaatcg
ctggaagccaataacggtcacgatggcacatggatcgctcacccgggccttgctgatacg
gcaatggcggtattcaacgatattctcggctcccgcaaaaaccagcttgaggtgatgcgc
gaacaagacgcgccgattactgccgatcagctgctggcaccttgtgctggtgaacgcacc
gaagaaggtatgcgcgccaacattcgcgtggctgtgcagtacatcgaagcgtggatctct
ggcaatggctgtgtgccgatttatggcctgatggaagatgcggcgacggctgaaatttcc
agtacctcaatctggcagtggatccatcatcaaaaaacgttgagcaatggcaaaccggtg
actaaagccttgttccgccagatgctgggcgaagagatgaaagtcattgccagcgaactg
ggcgaagaacgtttctcccatgggcgttttgacgatgccgcacgcttgatggaacagatc
accacttccgatgagttaattgatttcctgaccctgccaggctaccgcctgttagcgtaa

DBGET integrated database retrieval system