KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c5034Help
Entry
c5034             CDS       T00106                                 

Definition
dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:ecc01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ecc00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ecc00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4811179..4812234
Genome map
AA seq 351 aa AA seqDB search
MIAELETDKVILEIPAPHDGVLSNIIVSEGSTVTSAQLLAHLKPQAVIEETVTPVTETLA
MPSARLEAQRSGVELADVAGSGRNGRILKEDVQRVTPAPVIQPERVAEIAPAKPLTPGAR
QERREPMSRLRQRIAERLLASQQNNAILTTFNEVNMQSVMDLRARWKDRFAEKHGVKLGF
MSFFVKAVTRAQERFPVVNASVDGNEIIWRDYCDIGIAVSSNRGLVVPVLRNAQSLSLVE
IERQIAEYATQARNGKLPLEALQGGTFSITNGGTFGSMMSTPIINPPQSAILGMHAITPR
PVAENGQVVIRPMMYLALSYDHRIIDGQEAVQTLVAIRELLESPEQLLLDL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gtgattgccgagctggaaaccgataaagtcattctggaaataccggccccgcacgatggc
gtgttaagcaatattatcgtcagcgaaggtagcacggtcacgtccgcgcaactgttggcg
catcttaagccgcaagctgtcatagaagaaaccgtcacaccagtcaccgaaaccctggcg
atgccttccgcacggctggaggcacagcgtagtggtgtcgaacttgctgacgttgcgggg
agcgggagaaatggacgtatcctgaaagaggatgtacagcgcgttactcctgcaccagtc
attcagcctgaacgggtggcggagatcgcgccagctaaacccttgacaccgggtgctcgt
caggaacgtcgtgagccgatgtcgcgcttacgtcagcggattgctgagcgtctgctggct
tcccaacaaaataacgccattcttaccacattcaacgaagtaaacatgcagagcgtgatg
gatttacgcgcccgctggaaagatcgttttgccgagaagcacggcgtgaagctgggcttt
atgtccttctttgttaaggccgttacccgggcgcaggagcgcttccctgtagtgaatgcc
agcgttgatggcaacgagattatctggcgtgattattgcgatatcggcattgcagtgagc
agcaaccgcggcctggtagtgcctgtgttacgcaatgcgcaatcactctctttggtggaa
attgaacggcaaattgccgaatacgccacacaggcacgcaatggcaaattgccgctggag
gcgttacagggcggcacgttctctatcaccaacggcggtacttttggttcgatgatgtca
acgccaatcattaacccgccgcagtcggccattcttgggatgcatgccatcacgccgcgc
ccggtcgcagaaaacggccaggttgttattcgtcccatgatgtaccttgctctcagctat
gaccatcgcattatcgatggtcaggaagccgtgcagacattggtggcaatacgtgagcta
ctggaatcaccggaacaactgttgctggatctttaa

DBGET integrated database retrieval system