KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c5034Help
Entry
c5034             CDS       T00106                                 

Definition
(GenBank) Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00020  Citrate cycle (TCA cycle)
ecc00310  Lysine degradation
ecc01100  Metabolic pathways
ecc01110  Biosynthesis of secondary metabolites
ecc01120  Microbial metabolism in diverse environments
ecc01130  Biosynthesis of antibiotics
ecc01200  Carbon metabolism
Module
ecc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    c5034
  Amino acid metabolism
   00310 Lysine degradation
    c5034
Enzymes [BR:ecc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     c5034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl DUF4331
Motif
Other DBs
NCBI-ProteinID: AAN83460
UniProt: A0A0H2VEQ0
Position
4811179..4812234
Genome map
AA seq 351 aa AA seqDB search
MIAELETDKVILEIPAPHDGVLSNIIVSEGSTVTSAQLLAHLKPQAVIEETVTPVTETLA
MPSARLEAQRSGVELADVAGSGRNGRILKEDVQRVTPAPVIQPERVAEIAPAKPLTPGAR
QERREPMSRLRQRIAERLLASQQNNAILTTFNEVNMQSVMDLRARWKDRFAEKHGVKLGF
MSFFVKAVTRAQERFPVVNASVDGNEIIWRDYCDIGIAVSSNRGLVVPVLRNAQSLSLVE
IERQIAEYATQARNGKLPLEALQGGTFSITNGGTFGSMMSTPIINPPQSAILGMHAITPR
PVAENGQVVIRPMMYLALSYDHRIIDGQEAVQTLVAIRELLESPEQLLLDL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gtgattgccgagctggaaaccgataaagtcattctggaaataccggccccgcacgatggc
gtgttaagcaatattatcgtcagcgaaggtagcacggtcacgtccgcgcaactgttggcg
catcttaagccgcaagctgtcatagaagaaaccgtcacaccagtcaccgaaaccctggcg
atgccttccgcacggctggaggcacagcgtagtggtgtcgaacttgctgacgttgcgggg
agcgggagaaatggacgtatcctgaaagaggatgtacagcgcgttactcctgcaccagtc
attcagcctgaacgggtggcggagatcgcgccagctaaacccttgacaccgggtgctcgt
caggaacgtcgtgagccgatgtcgcgcttacgtcagcggattgctgagcgtctgctggct
tcccaacaaaataacgccattcttaccacattcaacgaagtaaacatgcagagcgtgatg
gatttacgcgcccgctggaaagatcgttttgccgagaagcacggcgtgaagctgggcttt
atgtccttctttgttaaggccgttacccgggcgcaggagcgcttccctgtagtgaatgcc
agcgttgatggcaacgagattatctggcgtgattattgcgatatcggcattgcagtgagc
agcaaccgcggcctggtagtgcctgtgttacgcaatgcgcaatcactctctttggtggaa
attgaacggcaaattgccgaatacgccacacaggcacgcaatggcaaattgccgctggag
gcgttacagggcggcacgttctctatcaccaacggcggtacttttggttcgatgatgtca
acgccaatcattaacccgccgcagtcggccattcttgggatgcatgccatcacgccgcgc
ccggtcgcagaaaacggccaggttgttattcgtcccatgatgtaccttgctctcagctat
gaccatcgcattatcgatggtcaggaagccgtgcagacattggtggcaatacgtgagcta
ctggaatcaccggaacaactgttgctggatctttaa

DBGET integrated database retrieval system