KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c5372Help
Entry
c5372             CDS       T00106                                 

Definition
hypothetical protein
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Brite
Enzymes [BR:ecc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     c5372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5116943..5120014)
Genome map
AA seq 1023 aa AA seqDB search
MKLKFKHQPYQAAAVQAVVDIFQGQPPASDAAMSYRLDPGNTKNGMGDLFAVDTGFKNAE
LTLSEVALLDNIQQVQRQQNLPLSESLVKTKVAKLNLDIEMETGTGKTYCYIKTVFELNK
QYGWSKFVIVVPSIAIREGVAKSLEITAEHFQETYHKKARFFIYNSKQLHHLESFSSDAG
INVMVINVQAFNATGKDNRRIYEALDDFQSRRPIDVISANRPILILDEPQRMEGGKTLDS
LANFNPLMVLRYSATHKTTHNKIHRLDALDAYNQKLVKKIEVRGISVKGLAGTNAYLYLQ
SIEISNKKPPVAVVEFEQKLSGGNIKRVTRKLGKGDNLFVLSNELDQYRDGFVVSDINAN
TDTLSFTNGVELTVGDVIGDISEIALRRIQIRETIKAHFDKEMELFDKGVKVLSLFFIDE
VARYRDYSAVDEKGEYAKIFEEEYAKHIQEVFDNGFMEGDAPYAKYLRRIAADKTHSGYF
SIDKKSKRLTDPKAAARGENAGLSDDVDAYDLILKDKERLLSLAEPVRFIFSHSALREGW
DNPNVFVICTLKHSDNTISRRQEVGRGLRLSVNQNGERMDHPSIVHDINVLTVVASESYK
DFVTALQKDISDSLSARPRVADKAYFTGKMLNTKEGPITVSDDQATDIEFYLIQNGYVDK
KRNITEKYHQAKKDGTLEALPDELQPYAEQVFQLINSVFSESQLMQVEDGRKPKRLQTNA
NFEKQEFKALWGRINRKATYSVLFDDVELVNNAIKALNDKNAGLRVTPLQYTIHRGKQAD
TATYDDLKKGIAFELKVTETESHTASIHSAVQYDLIGKLSEGTLLTRRTIAEILKGLHAD
VFAQFKSNPESFIAEVIRLVNEQKANVIIEHLAYDTLEDKFDLDIFTTGQSKQDLSKAGN
KLQNHIYDYVLTDSAIERKFVEELDTSKDVVVYAKLPRGFLIPTPVGDYNPDWAISFKEG
SVKHVYFVAETKGSMSSLDLRPIEATKIKCARKFFDAVNKTFAPENVKYDVVDSFSKLME
VVK
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttaaattcaaacatcaaccctatcaggctgccgcagtgcaggcggtcgtcgat
atttttcaggggcagccaccggcctctgatgcggccatgagctatcgccttgaccctggt
aataccaaaaacggtatgggtgatctgtttgcggtagatactggttttaaaaatgctgag
ctaacccttagtgaggttgcattgcttgataacatccagcaggtgcagcgccagcaaaat
ctgccgttgtcggagagcttggtcaagaccaaggtcgccaagctaaatcttgatatcgag
atggaaacgggtactggcaagacctattgctacatcaagacagtcttcgaactgaacaaa
cagtacggctggagcaagttcgtcatagtggtgccgagcattgccatccgcgagggcgta
gccaagtcgttggaaatcacggccgagcactttcaggagacctatcacaagaaggcacgc
ttctttatttacaactctaagcagctgcaccatctggagagtttctcctcagatgccggt
atcaatgtcatggtgatcaacgtacaagcgtttaacgccactggcaaagataaccgccgt
atctatgaagcgctcgatgattttcagtcacgtcgcccgatcgatgtgatcagcgcaaac
cgacccatcttgatcctcgatgagccgcagcggatggaggggggcaagaccctagattcc
ttggctaatttcaacccgttgatggtgttgcgctattccgctacacacaagaccacacac
aacaaaattcaccgcctagatgcgctcgatgcctacaaccagaagctggtgaagaagatt
gaggtgcgtggtatctcggtgaagggactggcgggaaccaatgcctatctctatttacaa
tccatcgaaatctcaaacaaaaaaccgccagtagcggttgtagagttcgaacagaaactc
agcggtggaaacatcaagcgcgtcactcgcaaactgggtaagggtgacaatctgtttgtg
ctatcgaacgagctggatcaataccgcgatgggtttgtggtatcggacatcaatgccaat
acggacaccttgagctttaccaatggcgtagaactgacggtgggtgatgtgattggtgat
atttccgagatagcgctgcgccgcattcagatccgtgagacgatcaaggcgcactttgat
aaggagatggagctcttcgataaaggggtgaaggttctctcgttgttctttattgacgaa
gtggccaggtaccgggactactccgctgtcgatgaaaagggagagtacgcaaaaatattt
gaagaggagtacgctaagcacattcaagaagtgtttgataatgggtttatggagggggat
gccccttatgctaaatatctacgccgcattgcggccgataagacgcatagcggctacttt
tccatcgacaagaagagcaagcgcctcacagatcccaaagccgctgcgcgcggtgaaaat
gcgggcttgtcggatgacgtagatgcttatgatctaatcctcaaagacaaggaacggtta
ttatcactagctgagccggtgcgttttatcttctcacactcggccttacgtgagggctgg
gataaccccaacgtgtttgttatctgcacactcaagcatagtgataacaccatttcacgc
cgccaagaggtcgggcgcggcctgcgtttgtccgtcaatcaaaatggtgaacgcatggat
cacccatccattgttcatgacattaacgtactgacagttgtggccagcgaaagttacaag
gacttcgtgaccgccttgcagaaggacattagcgactccttgtctgctcgcccgcgtgtg
gcggacaaggcctacttcacgggcaagatgctgaacacgaaggaaggcccgattacggtc
tcggacgaccaagccacggacatcgagttttatctgatccagaatggctacgtcgataag
aagcgcaatatcacagagaaataccaccaagctaagaaagacggcacattagaggcattg
ccggacgagctgcagccctatgcagagcaggtattccagctgattaacagcgtattcagc
gaaagccagctcatgcaggtagaagatggacgcaagcccaaaagactgcagaccaacgcc
aactttgaaaagcaggagttcaaagcgctgtgggggcgaatcaatcgcaaagctacctac
agcgtactgtttgatgatgttgagctagtgaacaatgcgatcaaggcgctcaatgataag
aatgctgggttacgagtaacgccgttacaatacaccattcaccgtggcaagcaggctgat
acggcaacttacgatgacctcaaaaagggtatcgccttcgagctgaaagttaccgaaaca
gaatcgcacaccgcctctatccactccgctgtgcagtacgacttgattggtaagttatca
gaggggactttgcttacaagacgaaccattgccgaaattctaaaaggtctccatgctgac
gtcttcgcgcaattcaagagcaacccggaaagtttcattgccgaagtcattcgcttggtc
aacgaacaaaaggccaatgtcatcatcgagcatctggcctatgacacgctagaagacaag
tttgatttggacatctttaccacgggtcagagcaaacaggatctcagtaaggctgggaat
aaattgcaaaatcacatctatgattacgtgcttaccgactctgcaattgagcgcaagttc
gtcgaagagttggataccagcaaggatgtggtggtatatgccaagttgccacgtggtttt
ctgatcccaacccctgtcggcgattacaaccccgactgggctatttccttcaaagaaggc
tcggtcaagcatgtgtatttcgttgctgagaccaagggctcgatgtcgtcactggattta
cggcctattgaagccaccaagattaaatgtgcccgtaagttcttcgatgcggttaacaag
acgtttgctccagaaaacgtgaagtatgacgtagtggatagcttcagtaagctgatggaa
gtggtgaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system