KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c5623Help
Entry
c5623             CDS       T00106                                 

Gene name
fdnG
Definition
(GenBank) Formate dehydrogenase, nitrate-inducible, major subunit
  KO
K08348  
formate dehydrogenase-N, alpha subunit [EC:1.1.5.6]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    c5623 (fdnG)
Enzymes [BR:ecc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.6  formate dehydrogenase-N
     c5623 (fdnG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1740228..1743275
Genome map
AA seq 1015 aa AA seqDB search
MDVSRRQFFKICAGGMAGTTVAALGFAPKQALAQARNYKLLRAKEIRNTCTYCSVGCGLL
MYSLGDGAKNAREAIYHIEGDPDHPVSRGALCPKGAGLLDYVNSENRLRYPEYRAPGSDK
WQRISWEEAFSRIAKLMKADRDANFIEKNEQGVTVNRWLSTGMLCASGASNETGMLTQKF
ARSLGMLAVDNQARVUHGPTVASLAPTFGRGAMTNHWVDIKNANVVMVMGGNAAEAHPVG
FRWAMEAKNNNDATLIVVDPRFTRTASVADIYAPIRSGTDITFLSGVLRYLIENNKINAE
YVKHYTNASLLVRDDFAFEDGLFSGYDAEKRQYDKSSWNYQFDENGYAKRDDTLTHPRCV
WNLLKAHVSRYTPDVVENICGTPKADFLKVCEVLASTSAPDRTTTFLYALGWTQHTVGAQ
NIRTMAMIQLLLGNMGMAGGGVNALRGHSNIQGLTDLGLLSTSLPGYLTLPSEKQVDLQS
YLEANTPKATLADQVNYWSNYPKFFVSLMKSFYGDAAQKENNWGYDWLPKWDQTYDVIKY
FNMMDEGKVTGYFCQGFNPVASFPDKNKVVSCLSKLKYMVVIDPLVTETSTFWQNHGESN
DVDPASIQTEVFRLPSTCFAEEDGSIANSGRWLQWHWKGQDAPGEARNDGEILAGIYHHL
RELYQAEGGKGVEPLIKMSWNYKQPHEPQSDEVAKENNGYALEDLYDANGVLIAKKGQLL
SSFAHLRDDGTTASSCWIYTGSWTEQGNQMANRDNSDPSGLGNTLGWAWAWPLNRRVLYN
RASADINGKPWDPKRMLIQWNGSKWTGNDIPDFGNAAPGTPTGPFIMQPEGMGRLFAINK
MAEGPFPEHYEPIETPLGTNPLHPNVVSNPVVRLYEQDALRMGKKEQFPYVGTTYRLTEH
FHTWTKHALLNAIAQPEQFVEISETLAAAKGINNGDRVTVSSKRGFIRAVAVVTRRLKPL
NVNGQQVETVGIPIHWGFEGVARKGYIANTLTPNVGDANSQTPEYKAFLVNIEKA
NT seq 3048 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcagtcgcagacaattttttaaaatctgcgcgggcggtatggcgggaacaaca
gtagcagcattgggctttgccccgaagcaagcactggctcaggcgcgaaactacaaatta
ttacgcgcgaaagagatccgtaacacctgcacatactgttccgtaggttgcgggctattg
atgtatagcctgggtgatggcgcgaaaaacgccagagaagcgatttatcacattgaaggt
gacccggatcatccggtaagccgtggtgcgctgtgcccgaaaggggccggtttgctggat
tacgtcaacagcgaaaaccgtctgcgctacccggaatatcgtgcgccaggttctgacaaa
tggcagcgcattagctgggaagaagcattctcccgtattgcgaagctgatgaaagccgac
cgtgacgctaactttattgaaaagaacgagcagggcgtaacggtaaaccgttggctttct
accggtatgctgtgtgcttccggtgccagcaacgaaaccgggatgctgactcaaaaattt
gcccgctccctcgggatgctggcggtagacaaccaggcgcgcgtctgacacggaccaacg
gtagcaagtcttgctccaacatttggtcgcggtgcgatgaccaaccactgggtggatatc
aaaaacgctaacgtcgtaatggtgatgggcggtaacgctgctgaagcgcatcccgtcggt
ttccgctgggcgatggaagcgaaaaacaacaacgatgcaaccttgatcgttgtcgatccc
cgttttacgcgtaccgcttctgtggcggatatttacgcacctattcgttccggtacggac
attacgttcctgtctggcgttttgcgctacctgatcgaaaacaacaaaatcaacgccgaa
tacgttaagcattacaccaacgccagcctgttggtgcgtgatgattttgctttcgaagac
ggtctgttcagcggctacgacgctgaaaaacgtcaatacgataagtcgtcctggaactat
cagttcgatgaaaacggctatgcgaaacgcgatgacacgctgactcatccgcgctgtgta
tggaatctgctgaaagcgcacgtttcccgctacacgccggacgtagtagaaaacatttgc
ggtacgccaaaagccgacttcctgaaagtgtgtgaagtgctggcctccaccagcgcaccg
gatcgcacaaccaccttcctgtacgcgctgggctggacgcagcacaccgtgggtgcgcag
aacatccgtacgatggcgatgatccagttgctgctcggtaacatgggtatggccggtggc
ggcgtgaacgcattgcgtggtcactccaacattcagggcctgactgacttaggcctgctc
tctaccagcctgccaggttatctgacgctgccgtcagaaaaacaggttgatttgcagtcg
tatctggaagcgaacacgccgaaagcgacgctggctgatcaggtgaactactggagcaac
tatccgaagtttttcgttagcctgatgaaatctttctacggcgatgccgcgcagaaagag
aacaactggggctacgactggctgccgaagtgggaccagacctacgacgtcatcaagtat
ttcaacatgatggatgaaggtaaagtcaccggttatttctgccagggctttaacccggtt
gcgtccttcccggacaaaaacaaagtggtgagctgcctgagcaagctgaagtacatggtg
gttatcgatccgctggtgactgaaacctctaccttctggcagaaccacggcgagtcgaac
gatgtcgatccggcatctattcagactgaagtattccgtctgccttcgacctgctttgct
gaagaagatggttctatcgctaactccggtcgctggttgcagtggcactggaaaggtcag
gacgcgccgggcgaagcacgtaacgacggcgaaattctggcgggtatctaccatcatctg
cgcgagctgtaccaggccgagggtggtaaaggcgtagaaccgctgataaagatgagctgg
aactacaagcagccgcacgaaccgcaatctgacgaagtagctaaagagaacaacggctac
gcgctggaagatctctatgatgccaatggcgtgctgattgcgaagaaaggtcagttgctg
agtagctttgcgcatctgcgtgatgacggtacaaccgcatcgtcttgctggatctacacc
ggtagctggacagagcagggcaaccagatggctaaccgcgataactccgacccatctggt
ctggggaatacgctgggatgggcctgggcgtggccgctcaaccgtcgcgtactctacaac
cgtgcttcggcggatatcaacggtaaaccgtgggatccgaaacggatgctgatccagtgg
aacggcagcaagtggacgggtaacgatattccggacttcggcaatgccgcgccaggtaca
ccaaccggaccgtttatcatgcagccggaagggatgggacgcctgtttgccatcaacaaa
atggcggaaggtccgttcccggaacactacgagccaattgaaacgccgctgggcactaac
ccgttgcatccgaacgtggtgtctaacccggttgttcgtctgtatgaacaagacgcactg
cggatgggtaaaaaagagcagttcccgtatgtgggtacgacctatcgtctgacggagcac
ttccacacctggaccaagcacgcattgctcaacgcaattgctcagccggaacagtttgtg
gaaatcagcgaaacgctggcggcggcgaaaggcattaataatggcgatcgtgtcactgtc
tcaagcaagcgtggctttatccgcgcggtggcggtggtaacgcgccgtctgaaaccgctg
aatgtaaacggtcagcaggttgaaacggtgggtattccaatccactggggctttgagggt
gtcgcgcgtaaaggttatatcgctaacactctgacgccgaatgtcggtgatgcaaactcg
caaacgccggaatataaagcgttcttagtcaacatcgagaaggcgtaa

DBGET integrated database retrieval system