KEGG   Escherichia coli K-12 DH10B: ECDH10B_0095Help
Entry
ECDH10B_0095      CDS       T00666                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase, dihydrolipoyltransacetylase component E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
ecd00010  Glycolysis / Gluconeogenesis
ecd00020  Citrate cycle (TCA cycle)
ecd00620  Pyruvate metabolism
ecd01100  Metabolic pathways
ecd01110  Biosynthesis of secondary metabolites
ecd01120  Microbial metabolism in diverse environments
ecd01130  Biosynthesis of antibiotics
ecd01200  Carbon metabolism
Module
ecd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ecd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECDH10B_0095 (aceF)
   00020 Citrate cycle (TCA cycle)
    ECDH10B_0095 (aceF)
   00620 Pyruvate metabolism
    ECDH10B_0095 (aceF)
Enzymes [BR:ecd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ECDH10B_0095 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA HlyD_3 DEC-1_N
Motif
Other DBs
NCBI-ProteinID: ACB01294
Structure
PDB: 

Jmol
Position
99799..101691
Genome map
AA seq 630 aa AA seqDB search
MAIEIKVPDIGADEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGIVKEIKVS
VGDKTQTGALIMIFDSADGAADAAPAQAEEKKEAAPAAAPAAAAAKDVNVPDIGSDEVEV
TEILVKVGDKVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVNVGDKVSTGSLIMVFEVA
GEAGAAAPAAKQEAAPAAAPAPAAGVKEVNVPDIGGDEVEVTEVMVKVGDKVAAEQSLIT
VEGDKASMEVPAPFAGVVKELKVNVGDKVKTGSLIMIFEVEGAAPAAAPAKQEAAAPAPA
AKAEAPAAAPAAKAEGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILRED
VQAYVKEAIKRAEAAPAATGGGIPGMLPWPKVDFSKFGEIEEVELGRIQKISGANLSRNW
VMIPHVTHFDKTDITELEAFRKQQNEEAAKRKLDVKITPVVFIMKAVAAALEQMPRFNSS
LSEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKGIIELSRELMTISKKARDGKLTA
GEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMLPISLS
FDHRVIDGADGARFITIINNTLSDIRRLVM
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagtaccggacatcggggctgatgaagttgaaatcaccgagatc
ctggtcaaagtgggcgacaaagttgaagccgaacagtcgctgatcaccgtagaaggcgac
aaagcctctatggaagttccgtctccgcaggcgggtatcgttaaagagatcaaagtctct
gttggcgataaaacccagaccggcgcactgattatgattttcgattccgccgacggtgca
gcagacgctgcacctgctcaggcagaagagaagaaagaagcagctccggcagcagcacca
gcggctgcggcggcaaaagacgttaacgttccggatatcggcagcgacgaagttgaagtg
accgaaatcctggtgaaagttggcgataaagttgaagctgaacagtcgctgatcaccgta
gaaggcgacaaggcttctatggaagttccggctccgtttgctggcaccgtgaaagagatc
aaagtgaacgtgggtgacaaagtgtctaccggctcgctgattatggtcttcgaagtcgcg
ggtgaagcaggcgcggcagctccggccgctaaacaggaagcagctccggcagcggcccct
gcaccagcggctggcgtgaaagaagttaacgttccggatatcggcggtgacgaagttgaa
gtgactgaagtgatggtgaaagtgggcgacaaagttgccgctgaacagtcactgatcacc
gtagaaggcgacaaagcttctatggaagttccggcgccgtttgcaggcgtcgtgaaggaa
ctgaaagtcaacgttggcgataaagtgaaaactggctcgctgattatgatcttcgaagtt
gaaggcgcagcgcctgcggcagctcctgcgaaacaggaagcggcagcgccggcaccggca
gcaaaagctgaagccccggcagcagcaccagctgcgaaagcggaaggcaaatctgaattt
gctgaaaacgacgcttatgttcacgcgactccgctgatccgccgtctggcacgcgagttt
ggtgttaaccttgcgaaagtgaagggcactggccgtaaaggtcgtatcctgcgcgaagac
gttcaggcttacgtgaaagaagctatcaaacgtgcagaagcagctccggcagcgactggc
ggtggtatccctggcatgctgccgtggccgaaggtggacttcagcaagtttggtgaaatc
gaagaagtggaactgggccgcatccagaaaatctctggtgcgaacctgagccgtaactgg
gtaatgatcccgcatgttactcacttcgacaaaaccgatatcaccgagttggaagcgttc
cgtaaacagcagaacgaagaagcggcgaaacgtaagctggatgtgaagatcaccccggtt
gtcttcatcatgaaagccgttgctgcagctcttgagcagatgcctcgcttcaatagttcg
ctgtcggaagacggtcagcgtctgaccctgaagaaatacatcaacatcggtgtggcggtg
gataccccgaacggtctggttgttccggtattcaaagacgtcaacaagaaaggcatcatc
gagctgtctcgcgagctgatgactatttctaagaaagcgcgtgacggtaagctgactgcg
ggcgaaatgcagggcggttgcttcaccatctccagcatcggcggcctgggtactacccac
ttcgcgccgattgtgaacgcgccggaagtggctatcctcggcgtttccaagtccgcgatg
gagccggtgtggaatggtaaagagttcgtgccgcgtctgatgctgccgatttctctctcc
ttcgaccaccgcgtgatcgacggtgctgatggtgcccgtttcattaccatcattaacaac
acgctgtctgacattcgccgtctggtgatgtaa

DBGET integrated database retrieval system