KEGG   Escherichia coli K-12 DH10B: ECDH10B_0101Help
Entry
ECDH10B_0101      CDS       T00666                                 

Gene name
speE
Definition
spermidine synthase
Orthology
K00797  
spermidine synthase [EC:2.5.1.16]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
Cysteine and methionine metabolism
Arginine and proline metabolism
beta-Alanine metabolism
Glutathione metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:ecd00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ECDH10B_0101 (speE)
   00330 Arginine and proline metabolism
    ECDH10B_0101 (speE)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECDH10B_0101 (speE)
   00480 Glutathione metabolism
    ECDH10B_0101 (speE)
Enzymes [BR:ecd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     ECDH10B_0101 (speE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(109702..110568)
Genome map
AA seq 288 aa AA seqDB search
MAEKKQWHETLHDQFGQYFAVDNVLYHEKTDHQDLIIFENAAFGRVMALDGVVQTTERDE
FIYHEMMTHVPLLAHGHAKHVLIIGGGDGAMLREVTRHKNVESITMVEIDAGVVSFCRQY
LPNHNAGSYDDPRFKLVIDDGVNFVNQTSQTFDVIISDCTDPIGPGESLFTSAFYEGCKR
CLNPGGIFVAQNGVCFLQQEEAIDSHRKLSHYFSDVGFYQAAIPTYYGGIMTFAWATDND
ALRHLSTEIIQARFLASGLKCRYYNPAIHTAAFALPQYLQDALASQPS
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaaaaaaacagtggcatgaaacgctacacgaccagtttgggcagtactttgcg
gtagataacgttctgtatcatgaaaagaccgatcaccaggatctgatcatttttgagaac
gctgcatttggtcgcgtaatggcgctggatggcgtagtacaaaccaccgagcgcgacgag
tttatctatcatgagatgatgacccatgttccgctactggcccatggtcacgcgaaacat
gtgctgattatcggcggcggcgacggtgccatgctgcgtgaagtaacccgacataaaaac
gttgagtcaatcacgatggtggaaatcgatgcgggtgtcgtatcgttctgccgtcagtat
ctacccaaccataacgccggtagctacgacgatccgcgctttaagctggtgatcgacgat
ggcgtcaatttcgttaatcaaaccagccagacctttgatgtcattatctccgactgcacc
gatcctatcggtcccggcgaaagccttttcacttcggcattttatgaaggctgcaaacgt
tgcctgaatcctggcggtatcttcgtcgcacaaaacggcgtctgctttttacagcaggaa
gaagccatcgacagccatcgcaaactcagccattacttcagcgacgttggcttttatcag
gcggcgatcccgacctattacggcggtatcatgacttttgcatgggcgacagataacgac
gccttacgccatctctcaaccgaaattattcaggcgcgttttctcgcctctggcctgaaa
tgccgttattacaatccggcaatccatacggcagcttttgccttacctcagtatctgcaa
gacgcactggcttcacagccgtcctaa

DBGET integrated database retrieval system