KEGG   Escherichia coli K-12 DH10B: ECDH10B_0359Help
Entry
ECDH10B_0359      CDS       T00666                                 

Gene name
malZ
Definition
maltodextrin glucosidase
Orthology
K01187  
alpha-glucosidase [EC:3.2.1.20]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ECDH10B_0359 (malZ)
   00500 Starch and sucrose metabolism
    ECDH10B_0359 (malZ)
Enzymes [BR:ecd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     ECDH10B_0359 (malZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
361070..362887
Genome map
AA seq 605 aa AA seqDB search
MMLNAWHLPVPPFVKQSKDQLLITLWLTGEDPPQRIMLRTEHDNEEMSVPMHKQRSQPQP
GVTAWRAAIDLSSGQPRRRYSFKLLWHDRQRWFTPQGFSRMPPARLEQFAVDVPDIGPQW
AADQIFYQIFPDRFARSLPREAEQDHVYYHHAAGQEIILRDWDEPVTAQAGGSTFYGGDL
DGISEKLPYLKKLGVTALYLNPVFKAPSVHKYDTEDYRHVDPQFGGDGALLRLRHNTQQL
GMRLVLDGVFNHSGDSHAWFDRHNRGTGGACHNPESPWRDWYSFSDDGTALDWLGYASLP
KLDYQSESLVNEIYRGEDSIVRHWLKAPWNMDGWRLDVVHMLGEAGGARNNMQHVAGITE
AAKETQPEAYIVGEHFGDARQWLQADVEDAAMNYRGFTFPLWGFLANTDISYDPQQIDAQ
TCMAWMDNYRAGLSHQQQLRMFNQLDSHDTARFKTLLGRDIARLPLAVVWLFTWPGVPCI
YYGDEVGLDGKNDPFCRKPFPWQVEKQDTALFALYQRMIALRKKSQALRHGGCQVLYAED
NVVVFVRVLNQQRVLVAINRGEACEVVLPASPFLNAVQWQCKEGHGQLTDGILALPAISA
TVWMN
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgatgttaaatgcatggcacctgccggtgcccccatttgttaaacaaagcaaagatcaa
ctgctcattacactgtggctgacgggcgaagacccaccgcagcgcattatgctgcgtaca
gaacacgataacgaagaaatgtcagtaccgatgcataagcagcgcagtcagccgcagcct
ggcgtcaccgcatggcgtgcggcgattgatctctccagcggacaaccccggcggcgttac
agtttcaaactgctgtggcacgatcgccagcgttggtttacaccgcagggcttcagccga
atgccgccggcacgactggagcagtttgccgtcgatgtaccggatatcggcccacaatgg
gctgcggatcagattttttatcagatcttccctgatcgttttgcgcgtagtcttcctcgt
gaagctgaacaggatcatgtctattaccatcatgcagccggacaagagatcatcttgcgt
gactgggatgaaccggtcacggcgcaggcgggcggatcaacgttctatggcggcgatctg
gacgggataagcgaaaaactgccgtatctgaaaaagcttggcgtgacagcgctgtatctc
aatccggtgtttaaagctcccagcgtacataaatacgataccgaggattatcgccatgtc
gatccgcagtttggcggtgatggggcgttgctgcgtttgcgacacaatacgcagcagctg
ggaatgcggctggtgctggacggcgtgtttaaccacagtggcgattcccatgcctggttt
gacaggcataatcgtggcacgggtggtgcttgtcacaaccccgaatcgccctggcgcgac
tggtactcgtttagtgatgatggcacggcgctcgactggcttggctatgccagcttgccg
aagctggattatcagtcggaaagtctggtgaatgaaatttatcgcggggaagacagtatt
gtccgccactggctgaaagcgccgtggaatatggacggctggcggctggatgtggtgcat
atgctgggggaggcgggtggggcgcgcaataatatgcagcacgttgccgggatcaccgaa
gcggcgaaagaaacccagccggaagcgtatattgtcggcgaacattttggcgatgcacgg
caatggttacaggccgatgtggaagatgccgccatgaactatcgtggcttcacattcccg
ttgtggggatttcttgccaataccgatatctcttacgatccgcagcaaattgatgcccaa
acctgtatggcctggatggataattaccgcgcagggctttctcatcaacaacaattacgt
atgtttaatcagctcgacagccacgatactgcgcgatttaaaacgctgctcggtcgggat
attgcgcgcctgccgctggcggtggtctggctgttcacctggcctggtgtaccgtgcatt
tattacggtgatgaagtaggactggatggcaaaaacgatccgttttgccgtaaaccgttc
ccctggcaggtggaaaagcaggatacggcgttattcgcgctgtaccagcgaatgattgcg
ctgcgtaagaaaagtcaggcgctacgtcatggcggctgtcaggtgctgtatgcggaagat
aacgtggtggtatttgtccgcgtgctgaatcagcaacgtgtactggtggcaatcaaccgt
ggcgaggcctgtgaagtggtgctacccgcgtcaccgtttctcaatgccgtgcaatggcaa
tgcaaagaagggcatgggcaactgactgacgggattctggctttgcctgccatttcggct
acggtatggatgaactaa

DBGET integrated database retrieval system