KEGG   Escherichia coli K-12 DH10B: ECDH10B_0620Help
Entry
ECDH10B_0620      CDS       T00666                                 

Gene name
ybcS
Definition
DLP12 prophage; lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ecd  Escherichia coli K-12 DH10B
Brite
Enzymes [BR:ecd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     ECDH10B_0620 (ybcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
629428..629925
Genome map
AA seq 165 aa AA seqDB search
MPPSLRKAVAAAIGGGAIAIASVLITGPSGNDGLEGVSYIPYKDIVGVWTVCHGHTGKDI
MLGKTYTKAECKALLNKDLATVARQINPYIKVDIPETTRGALYSFVYNVGAGNFRTSTLL
RKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREVCLWGQQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcctccatcattacgaaaagccgttgctgctgctattggtggcggagcaattgctata
gcatcagtgttaatcactggcccaagtggtaacgatggtctggaaggtgtcagctacata
ccatacaaagatattgttggtgtatggactgtatgtcacggacacaccggaaaagacatc
atgctcggtaaaacgtataccaaagcagaatgcaaagcactcttgaataaagaccttgcc
actgtcgccagacaaattaacccgtatatcaaagtcgatataccggaaacaacgcgcggc
gctctttactcattcgtttacaacgtgggtgctggcaattttagaacatcgacgcttctt
cgcaaaataaaccagggcgatatcaaaggcgcatgtgatcagctgcgtcgctggacatac
gctggcggtaagcaatggaaaggcctgatgactcgtcgtgagattgagcgtgaagtctgt
ttgtgggggcaacagtga

DBGET integrated database retrieval system