KEGG   Escherichia coli K-12 DH10B: ECDH10B_0726Help
Entry
ECDH10B_0726      CDS       T00666                                 

Gene name
lnt
Definition
apolipoprotein N-acyltransferase
Orthology
K03820  
apolipoprotein N-acyltransferase [EC:2.3.1.-]
Organism
ecd  Escherichia coli K-12 DH10B
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(741158..742696)
Genome map
AA seq 512 aa AA seqDB search
MAFASLIERQRIRLLLALLFGACGTLAFSPYDVWPAAIISLMGLQALTFNRRPLQSAAIG
FCWGFGLFGSGINWVYVSIATFGGMPGPVNIFLVVLLAAYLSLYTGLFAGVLSRLWPKTT
WLRVAIAAPALWQVTEFLRGWVLTGFPWLQFGYSQIDGPLKGLAPIMGVEAINFLLMMVS
GLLALALVKRNWRPLVVAVVLFALPFPLRYIQWFTPQPEKTIQVSMVQGDIPQSLKWDEG
QLLNTLKIYYNATAPLMGKSSLIIWPESAITDLEINQQPFLKALDGELRDKGSSLVTGIV
DARLNKQNRYDTYNTIITLGKGAPYSYESADRYNKNHLVPFGEFVPLESILRPLAPFFDL
PMSSFSRGPYIQPPLSANGIELTAAICYEIILGEQVRDNFRPDTDYLLTISNDAWFGKSI
GPWQHFQMARMRALELARPLLRSTNNGITAVIGPQGEIQAMIPQFTREVLTTNVTPTTGL
TPYARTGNWPLWVLTALFGFAAVLMSLRQRRK
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgcctcattaattgaacgccagcgcattcgcctgctgctggcgttattattc
ggtgcctgcggaacgctggccttctctccttacgacgtctggcctgcggcgattatttcg
ctgatggggcttcaggcgttgacctttaaccgccgtccactccagtctgccgctattggc
ttttgctggggatttggcctctttggcagcggtattaactgggtctatgtcagcatcgcg
acctttggcggaatgcctggcccggttaacatcttcctggtggtgctgctggcggcgtat
ttgtcgctgtataccggactgtttgctggcgtgctgtcgcgtctgtggccgaaaaccacc
tggctgcgcgtagcgattgccgcccctgccctctggcaagtgaccgagtttctgcgcggt
tgggtactgaccggcttcccgtggttacagttcggctatagccagattgatggcccgtta
aaagggctggcaccgataatgggcgtggaagccattaacttcctgctgatgatggttagt
ggcctgctggcactggcgttggtcaaacgcaactggcgtccgctggtggtggccgtcgtg
ctgtttgcccttcccttcccgctgcgttacatccagtggtttaccccacaaccggagaaa
accattcaggtttcgatggttcagggcgatattccgcaatcgctgaaatgggacgaaggc
cagcttcttaatacgctgaagatttactacaacgcaacggcaccgctgatgggcaaatca
tcgttgattatctggccggagtcggcgataaccgatctggaaattaatcagcaaccgttc
ctcaaagcactggacggtgagttgcgtgataaaggtagctcgctggtaaccgggattgtc
gacgcgcgtctcaataagcagaaccgctacgatacctacaacaccatcatcacgctgggt
aaaggtgcgccgtacagctacgaatcagccgatcgctataacaaaaaccatctggtgccg
tttggcgagtttgtcccgctggagtcgattctgcgtccgttagcaccgttctttgatctg
ccgatgtcgtcgttcagccgtgggccatatatccagccgccgctgtcggcaaatggtatt
gagcttactgcggctatttgctacgagatcattctcggcgagcaagtgcgcgataacttc
cgcccggataccgactatctgctgactatctccaacgatgcgtggtttggtaaatctatt
ggtccatggcaacacttccagatggcgcgaatgcgtgcgctggagctggcgcgcccactg
ttgcgcagcaccaacaacggcattacggcggtgattggcccgcagggtgagattcaggcg
atgatcccgcagttcacccgcgaggtgttaaccactaacgtgacgccgaccaccggactc
acaccatacgcacgtaccggcaactggccgctgtgggtgctgacggcattgtttggtttt
gctgctgtgttgatgagtctgcgtcagcgacgtaaataa

DBGET integrated database retrieval system