KEGG   Escherichia coli K-12 DH10B: ECDH10B_1005Help
Entry
ECDH10B_1005      CDS       T00666                                 

Gene name
ssuD
Definition
(GenBank) alkanesulfonate monooxygenase, FMNH(2)-dependent
  KO
K04091  
alkanesulfonate monooxygenase [EC:1.14.14.5]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:ecd00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    ECDH10B_1005 (ssuD)
Enzymes [BR:ecd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.5  alkanesulfonate monooxygenase
     ECDH10B_1005 (ssuD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1047994..1049139)
Genome map
AA seq 381 aa AA seqDB search
MSLNMFWFLPTHGDGHYLGTEEGSRPVDHGYLQQIAQAADRLGYTGVLIPTGRSCEDAWL
VAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDRLSNGRALFNLVTGSDPQELAGDG
VFLDHSERYEASAEFTQVWRRLLQRETVDFNGKHIHVRGAKLLFPAIQQPYPPLYFGGSS
DVAQELAAEQVDLYLTWGEPPELVKEKIEQVRAKAAAHGRKIRFGIRLHVIVRETNDEAW
QAAERLISHLDDETIAKAQAAFARTDSVGQQRMAALHNGKRDNLEISPNLWAGVGLVRGG
AGTALVGDGPTVAARINEYAALGIDSFVLSGYPHLEEAYRVGELLFPLLDVAIPEIPQPQ
PLNPQGEAVANDFIPRKVAQS
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgaatatgttctggtttttaccgacccacggtgacgggcattatctgggaacg
gaagaaggttcacgcccggttgatcacggttatctgcaacaaattgcgcaagcggcggat
cgtcttggctataccggtgtgctaattccaacggggcgctcctgcgaagatgcgtggctg
gttgccgcatcgatgatcccggtgacgcagcggctgaagtttcttgtcgccctgcgtccc
agcgtaacctcacctaccgttgccgcccgccaggccgccacgcttgaccgtctctcaaat
ggacgtgcgttgtttaacctggtcacaggcagcgatccacaagagctggcaggcgacgga
gtgttccttgatcatagcgagcgctacgaagcctcggcggaatttacccaggtctggcgg
cgtttattgcagagagaaaccgtcgatttcaacggtaaacatattcatgtgcgcggagca
aaactgctcttcccggcgattcaacagccgtatccgccactttactttggcggatcgtca
gatgtcgcccaggagctggcggcagaacaggttgatctctacctcacctggggcgaaccg
ccggaactggttaaagagaaaatcgaacaagtgcgggcgaaagctgccgcgcatggacgc
aaaattcgtttcggtattcgtctgcatgtgattgttcgtgaaactaacgacgaagcgtgg
caggccgccgagcggttaatctcgcatcttgatgatgaaactatcgccaaagcacaggcc
gcattcgcccggacggattccgtagggcaacagcgaatggcggcgttacataacggcaag
cgcgacaatctggagatcagccccaatttatgggcgggcgttggcttagtgcgcggcggt
gccgggacggcgctggtgggcgatggtcctacggtcgctgcgcgaatcaacgaatatgcc
gcgcttggcatcgacagttttgtgctttcgggctatccgcatctggaagaagcgtatcgg
gttggcgagttgctgttcccgcttctggatgtcgccatcccggaaattccccagccgcag
ccgctgaatccgcaaggcgaagcggtggcgaatgattttatcccccgtaaagtcgcgcaa
agctaa

DBGET integrated database retrieval system