KEGG   Escherichia coli K-12 DH10B: ECDH10B_1296Help
Entry
ECDH10B_1296      CDS       T00666                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ecd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECDH10B_1296 (galU)
   00052 Galactose metabolism
    ECDH10B_1296 (galU)
   00500 Starch and sucrose metabolism
    ECDH10B_1296 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    ECDH10B_1296 (galU)
Enzymes [BR:ecd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ECDH10B_1296 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1330921..1331829
Genome map
AA seq 302 aa AA seqDB search
MAAINTKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLDEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAHPVVGDEPVAVILPDVILDEYESDLSQDNLAEMIRRFDETGHSQIMVEPVADVTAYGV
VDCKGVELAPGESVPMVGVVEKPKADVAPSNLAIVGRYVLSADIWPLLAKTPPGAGDEIQ
LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGTEFKAWLEEEMGI
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctgccattaatacgaaagtcaaaaaagccgttatccccgttgcgggattaggaacc
aggatgttgccggcgacgaaagccatcccgaaagagatgctgccacttgtcgataagcca
ttaattcaatacgtcgtgaatgaatgtattgcggctggcattactgaaattgtgctggtt
acacactcatctaaaaactctattgaaaaccactttgataccagttttgaactggaagca
atgctggaaaaacgtgtaaaacgtcaactgcttgatgaagtgcagtctatttgtccaccg
cacgtgactattatgcaagttcgtcagggtctggcgaaaggcctgggacacgcggtattg
tgtgctcacccggtagtgggtgatgaaccggtagctgttattttgcctgatgttattctg
gatgaatatgaatccgatttgtcacaggataacctggcagagatgatccgccgctttgat
gaaacgggtcatagccagatcatggttgaaccggttgctgatgtgaccgcatatggcgtt
gtggattgcaaaggcgttgaattagcgccgggtgaaagcgtaccgatggttggtgtggta
gaaaaaccgaaagcggatgttgcgccgtctaatctcgctattgtgggtcgttacgtactt
agcgcggatatttggccgttgctggcaaaaacccctccgggagctggtgatgaaattcag
ctcaccgacgcaattgatatgctgatcgaaaaagaaacggtggaagcctatcatatgaaa
gggaagagccatgactgcggtaataaattaggttacatgcaggccttcgttgaatacggt
attcgtcataacacccttggcacggaatttaaagcctggcttgaagaagagatgggcatt
aagaagtaa

DBGET integrated database retrieval system