KEGG   Escherichia coli K-12 DH10B: ECDH10B_2504Help
Entry
ECDH10B_2504      CDS       T00666                                 

Gene name
fadJ
Definition
(GenBank) fused enoyl-CoA hydratase and epimerase and isomerase; 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
ecd00071  Fatty acid degradation
ecd00280  Valine, leucine and isoleucine degradation
ecd00281  Geraniol degradation
ecd00310  Lysine degradation
ecd00362  Benzoate degradation
ecd00380  Tryptophan metabolism
ecd00410  beta-Alanine metabolism
ecd00640  Propanoate metabolism
ecd00650  Butanoate metabolism
ecd00903  Limonene and pinene degradation
ecd00930  Caprolactam degradation
ecd01040  Biosynthesis of unsaturated fatty acids
ecd01100  Metabolic pathways
ecd01110  Biosynthesis of secondary metabolites
ecd01120  Microbial metabolism in diverse environments
ecd01130  Biosynthesis of antibiotics
ecd01200  Carbon metabolism
ecd01212  Fatty acid metabolism
Module
ecd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ecd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ECDH10B_2504 (fadJ)
   00650 Butanoate metabolism
    ECDH10B_2504 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    ECDH10B_2504 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    ECDH10B_2504 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECDH10B_2504 (fadJ)
   00310 Lysine degradation
    ECDH10B_2504 (fadJ)
   00380 Tryptophan metabolism
    ECDH10B_2504 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECDH10B_2504 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ECDH10B_2504 (fadJ)
   00281 Geraniol degradation
    ECDH10B_2504 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECDH10B_2504 (fadJ)
   00930 Caprolactam degradation
    ECDH10B_2504 (fadJ)
Enzymes [BR:ecd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ECDH10B_2504 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ECDH10B_2504 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ECDH10B_2504 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ACB03499
UniProt: B1X9L4
Position
complement(2546802..2548946)
Genome map
AA seq 714 aa AA seqDB search
MEMTSAFTLNVRLDNIAVITIDVPGEKMNTLKAEFASQVRAIIKQLRENKELRGVVFVSA
KPDNFIAGADINMIGNCKTAQEAEALARQGQQLMAEIHALPIQVIAAIHGACLGGGLELA
LACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQAL
KLGLVDDVVPHSILLEAAVELAKKERPSSRPLPVRERILAGPLGRALLFKMVGKKTEHKT
QGNYPATERILEVVETGLAQGTSSGYDAEARAFGELAMTPQSQALRSIFFASTDVKKDPG
SDAPPAPLNSVGILGGGLMGGGIAYVTACKAGIPVRIKDINPQGINHALKYSWDQLEGKV
RRRHLKASERDKQLALISGTTDYRGFAHRDLIIEAVFENLELKQQMVAEVEQNCAAHTIF
ASNTSSLPIGDIAAHATRPEQVIGLHFFSPVEKMPLVEIIPHAGTSAQTIATTVKLAKKQ
GKTPIVVRDKAGFYVNRILAPYINEAIRMLTQGERVEHIDAALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGERFSAPANVVSSILNDDRKGRKNGRGFYLYGQKGRKSKKQVDPA
IYPLIGTQGQGRISAPQVAERCVMLMLNEAVRCVDEQVIRSVRDGDIGAVFGIGFPPFLG
GPFRYIDSLGAGEVVAIMQRLATQYGSRFTPCERLVEMGARGESFWKTTATDLQ
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgacatcagcgtttacccttaatgttcgtctggacaacattgccgttatcacc
atcgacgtaccgggtgagaaaatgaataccctgaaggcggagtttgcctcgcaggtgcgc
gccattattaagcaactccgtgaaaacaaagagttgcgaggcgtggtgtttgtctccgct
aaaccggacaacttcattgctggcgcagacatcaacatgatcggcaactgcaaaacggcg
caagaagcggaagctctggcgcggcagggccaacagttgatggcggagattcatgctttg
cccattcaggttatcgcggctattcatggcgcttgcctgggtggtgggctggagttggcg
ctggcgtgccacggtcgcgtttgtactgacgatcctaaaacggtgctcggtttgcctgaa
gtacaacttggattgttacccggttcaggcggcacccagcgtttaccgcgtctgataggc
gtcagcacagcattagagatgatcctcaccggaaaacaacttcgggcgaaacaggcatta
aagctggggctggtggatgacgttgttccgcactccattctgctggaagccgctgttgag
ctggcaaagaaggagcgcccatcttcccgccctctacctgtacgcgagcgtattctggcg
gggccgttaggtcgtgcgctgctgttcaaaatggtcggcaagaaaacagaacacaaaact
caaggcaattatccggcgacagaacgcatcctggaggttgttgaaacgggattagcgcag
ggcaccagcagcggttatgacgccgaagctcgggcgtttggcgaactggcgatgacgcca
caatcgcaggcgctgcgtagtatcttttttgccagtacggacgtgaagaaagatcccggc
agtgatgcgccgcctgcgccattaaacagcgtggggattttaggtggtggcttgatgggc
ggcggtattgcttatgtcactgcttgtaaagcggggattccggtcagaattaaagatatc
aacccgcagggcataaatcatgcgctgaagtacagttgggatcagctggagggcaaagtt
cgccgtcgtcatctcaaagccagcgaacgtgacaaacagctggcattaatctccggaacg
acggactatcgcggctttgcccatcgcgatctgattattgaagcggtgtttgaaaatctc
gaattgaaacaacagatggtggcggaagttgagcaaaattgcgccgctcataccatcttt
gcttcgaatacgtcatctttaccgattggtgatatcgccgctcacgccacgcgacctgag
caagttatcggcctgcatttcttcagtccggtggaaaaaatgccgctggtggagattatt
cctcatgcggggacatcggcgcaaaccatcgctaccacagtaaaactggcgaaaaaacag
ggtaaaacgccaattgtcgtgcgtgacaaagccggtttttacgtcaatcgcatcttagcg
ccttacattaatgaagctatccgcatgttgacccaaggtgaacgggtagagcacattgat
gccgcgctagtgaaatttggttttccggtaggcccaatccaacttttggatgaggtagga
atcgacaccgggactaaaattattcctgtactggaagccgcttatggagaacgttttagc
gcgcctgcaaatgttgtttcttcaattttgaacgacgatcgcaaaggcagaaaaaatggc
cggggtttctatctttatggtcagaaagggcgtaaaagcaaaaaacaggtcgatcccgcc
atttacccgctgattggcacacaagggcaggggcgaatctccgcaccgcaggttgctgaa
cggtgtgtgatgttgatgctgaatgaagcagtacgttgtgttgatgagcaggttatccgt
agcgtgcgtgacggggatattggcgcggtatttggcattggttttccgccatttctcggt
ggaccgttccgctatatcgattctctcggcgcgggcgaagtggttgcaataatgcaacga
cttgccacgcagtatggttcccgttttaccccttgcgagcgtttggtcgagatgggcgcg
cgtggggaaagtttttggaaaacaactgcaactgacctgcaataa

DBGET integrated database retrieval system