KEGG   Escherichia coli K-12 DH10B: ECDH10B_3734Help
Entry
ECDH10B_3734      CDS       T00666                                 

Gene name
yiaG
Definition
(GenBank) predicted transcriptional regulator
  KO
K07726  
putative transcriptional regulator
Organism
ecd  Escherichia coli K-12 DH10B
Brite
Transcription factors [BR:ecd03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    ECDH10B_3734 (yiaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3815078..3815368
Genome map
AA seq 96 aa AA seqDB search
MEYKDPMHELLSSLEQIVFKDETQKITLTHRTTSCTEIEQLRKGTGLKIDDFARVLGVSV
AMVKEWESRRVKPSSAELKLMRLIQANPALSKQLME
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atggaatataaagatccaatgcatgagctgttgagcagcctggaacagattgtttttaaa
gatgaaacgcagaaaattaccctgacgcacagaacaacgtcctgtaccgaaattgagcag
ttacgaaaagggacaggattaaaaatcgatgatttcgcccgggttttgggcgtatcagtc
gccatggtaaaggaatgggaatccagacgcgtgaagccttcaagtgccgaactaaaattg
atgcgtttgattcaagccaacccggcattaagtaagcagttgatggaatag

DBGET integrated database retrieval system