KEGG   Escherichia coli K-12 DH10B: ECDH10B_3736Help
Entry
ECDH10B_3736      CDS       T00666                                 

Gene name
hokA
Definition
(GenBank) toxic polypeptide, small
  KO
K18920  
protein HokA
Organism
ecd  Escherichia coli K-12 DH10B
Brite
Prokaryotic defense system [BR:ecd02048]
 Toxin-antitoxin system (TA system)
  Type I TA system
   Hok-Sok
    ECDH10B_3736 (hokA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3816048..3816200)
Genome map
AA seq 50 aa AA seqDB search
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQESYELAAFLACKLKE
NT seq 153 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagaaatatagattactttctttaatagtgatttgtttcacgcttttatttttc
acctggatgataagagattcactgtgtgaattgcatattaaacaggagagttatgagctg
gcggcgtttttagcctgcaaattgaaagagtaa

DBGET integrated database retrieval system