KEGG   Escherichia coli K-12 DH10B: ECDH10B_3739Help
Entry
ECDH10B_3739      CDS       T00666                                 

Gene name
glyS
Definition
(GenBank) glycine tRNA synthetase, beta subunit
  KO
K01879  
glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ecd00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    ECDH10B_3739 (glyS)
Enzymes [BR:ecd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     ECDH10B_3739 (glyS)
Amino acid related enzymes [BR:ecd01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   ECDH10B_3739 (glyS)
Transfer RNA biogenesis [BR:ecd03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    ECDH10B_3739 (glyS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3817928..3819997)
Genome map
AA seq 689 aa AA seqDB search
MSEKTFLVEIGTEELPPKALRSLAESFAANFTAELDNAGLAHGTVQWFAAPRRLALKVAN
LAEAQPDREIEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERLTTDKGEWLLYRA
HVKGESTEALLPNMVATSLAKLPIPKLMRWGASDVHFVRPVHTVTLLLGDKVIPATILGI
QSDRVIRGHRFMGEPEFTIDNADQYPEILRERGKVIADYEERKAKIKADAEEAARKIGGN
ADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYFPVYANDGKLLPN
FIFVANIESKDPQQIISGNEKVVRPRLADAEFFFNTDRKKRLEDNLPRLQTVLFQQQLGT
LRDKTDRIQALAGWIAEQIGADVNHATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHD
GEAEDVAVALNEQYQPRFAGDDLPSNPVACALAIADKMDTLAGIFGIGQHPKGDKDPFAL
RRAALGVLRIIVEKNLNLDLQTLTEEAVRLYGDKLTNANVVDDVIDFMLGRFRAWYQDEG
YTVDTIQAVLARRPTRPADFDARMKAVSHFRTLDAAAALAAANKRVSNILAKSDEVLSDR
VNASTLKEPEEIKLAMQVVVLRDKLEPYFTEGRYQDALVELAELREPVDAFFDKVMVMVD
DKELRINRLTMLEKLRELFLRVADISLLQ
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaaaacttttctggtggaaatcggcactgaagagctgccaccaaaagcactg
cgcagcctggctgagtcctttgctgcgaactttactgcggagctggataacgctggcctc
gcacacggcaccgttcaatggtttgctgctccgcgtcgtctggcgctgaaagtagctaac
ctggcggaagcgcaaccggatcgtgaaatcgaaaaacgcggcccggcgattgcccaggcg
ttcgacgctgaaggcaaaccgagcaaagcggcagaaggttgggcgcgtggttgcggtatt
accgttgaccaggctgagcgtctgactaccgataaaggcgaatggctgctgtatcgcgcc
catgtgaagggcgaaagcaccgaagcactgctgccgaatatggttgcgacttctctggcg
aaactgccgatcccgaaactgatgcgttggggcgcaagcgacgtgcacttcgtgcgtccg
gtgcacaccgtgaccctgctgctgggcgacaaagtcattccggcaaccattctgggcatt
cagtccgatcgcgtgattcgcggccaccgctttatgggcgagccggaattcaccatcgat
aacgccgatcagtatccggaaattctgcgtgagcgtgggaaagtcatcgccgattacgaa
gaacgtaaggcgaagattaaagccgatgccgaagaagcagcgcgtaagattggcggtaac
gctgacttaagcgaaagcctgctggaagaagtggcttcgctggtggagtggccggtcgtt
ctgaccgcaaaattcgaagagaaattcctcgcggtgccggctgaagcgctggtttacacc
atgaaaggtgaccagaaatacttcccggtgtatgcgaacgacggcaaactgctgccgaac
tttatcttcgttgccaacatcgaatcgaaagatccgcagcagattatctccggtaacgag
aaagtcgttcgtccgcgtctggcggatgccgagttcttcttcaacaccgaccgtaaaaaa
cgtcttgaagataacctgccgcgcctgcaaaccgtgttgttccagcaacagttggggacg
ctgcgcgacaaaactgaccgcatccaggcgctggctggctggattgctgaacagattggc
gctgacgttaaccacgctacccgtgcgggtctgctgtctaagtgcgacctgatgaccaac
atggtcttcgagttcaccgacacccagggcgttatggggatgcactatgcgcgtcacgat
ggcgaagcggaagatgtcgcggtggcgctgaatgagcagtatcagccgcgttttgctggt
gatgacctgccgtccaacccagtagcttgtgcgctggcgattgctgacaagatggatacc
ctggcgggtatcttcggtatcggtcagcatccgaaaggcgacaaagacccgtttgcgctg
cgtcgtgccgcgcttggcgtgctgcgaattatcgttgagaagaacctcaaccttgatctg
caaacgctgaccgaagaagcggtgcgtctgtatggcgataagctgactaatgccaacgta
gttgatgatgttatcgactttatgctcggtcgcttccgcgcctggtatcaggacgaaggt
tataccgttgacaccatccaggcggtactggcgcgtcgtccgactcgtccggctgatttc
gatgcccgtatgaaagcggtatcgcatttccgtaccctggatgcagctgctgcactggcg
gcggcgaacaaacgtgtatctaacattctggcgaaatctgacgaagtgctgagcgaccgc
gtgaatgcctctaccctgaaagagccggaagaaattaaactggcgatgcaggttgtggtg
ctacgtgacaagctggagccgtactttacggaaggtcgttaccaggatgcgctggtcgaa
ctggctgagctgcgtgaaccggttgatgctttcttcgataaagtgatggtcatggttgat
gacaaagaattgcgtatcaaccgtctgaccatgctggagaaactgcgcgaactgttcctg
cgcgttgcggatatttcgctgttgcaataa

DBGET integrated database retrieval system